MUSCLE (3.8) multiple sequence alignment

NDAI0B05860        MRTAMAMAMAMAMAMVMGDVTCVLDIKGPSITTTAEMFGCLWKGGGGTKRGDTFRGDDPP
NCAS0F03550        --------------------MITAKQRSQTIQLDQEHFDQFYDQYVTELNESRRR-----
TBLA0C04480        ---------------------MPSSLLSSNRHSKKNKLHHNSH--NKKRKNGNTD-----
Ecym_1237          -----------------------MSSIFKKNKQP-DPFKELLD--NEEDKHGTTE-----
AFR310C            ----------------------MSIALFKKKLKPADPFEELSGL-PEEKKKDPTE-----
KAFR0G03690        ----------------------MAVNYYAD-----DRFIEVLK--EQERAKNPHR-----
ZYRO0D09988g       --------------------------MFRSKRP--DPFTGLYE--EAHRREQARK-----
KNAG0A07940        ---------------------MWSMLLGKKRK----------------------------
Kpol_480.14        --------------------------MFKKRE------GIVID--DTETDGNRSR-----
TPHA0D04250        ---------------------------MSKRK---DTFTVL----EDHPGQEPQQ-----
TDEL0D05600        --------------------------MFKQKRS--DPFAQYWAGDQAKDVEEQQK-----
KLLA0D16236g       ---------------------MVGLNLFRKRNEI-DPFAGLLD--DADHAAEQQQ---QH
SAKL0F02772g       ------------------------MSIFKKKQQV-DPFAHLLQ--PEQPQEQP-------
KLTH0F14828g       --------------------------MFKKRQ---DPLEHLFQ--QSEPQTGDAD-----
Kwal_55.21229      --------------------------MFKKKH---DPFEHLFQ--QDQPKKETSK-----
CAGL0I10516g       -------------------------MSFKSD----DPIGRLLQEGSQEKKKSILTRSVED
Suva_7.418         -------------------------MLFNTSRQEDDPFTQLINQSSAQNQQVQQQ-----
Skud_7.441         -------------------------MLFNTNRQDEDPFTQLINQSSANAQNQREQ-----
Smik_6.226         -------------------------MLFNINRQNDDPFTQLIN--QSSENGQSKQ---AQ
YGR130C            -------------------------MLFNINRQEDDPFTQLIN--QSSANTQNQQ---AH
NDAI0G00940        ----------------------MSLKLGSKKN---DPFEHLLN--PQPKTTGSSD---SS
NCAS0E00810        --------------------MPSSILSFKRRD---DPFDHLFE--EAEAAEAAKH---NT
KNAG0B00810        ----------------------MAIAGYDRLVQEHEDAVSLQSSGASSRGSRVSR-----
KAFR0C01960        --------------------------MFKTRSLADEAFDKLLSETTSVKTTDTAK-----
                                                                               

NDAI0B05860        GMRGRERRGRLCRCVQ-------------------------KGGHPDNPDI---------
NCAS0F03550        -------GTHITQFNA------------VEN----------EESLTPNARFVS-------
TBLA0C04480        ---SVEPSDVLQTAIN--------------S----------HTLHGKGKQYKS-------
Ecym_1237          --------LFVKKVTN-----HRKASEDDGT----------QGNVEGGGEYVS-------
AFR310C            ---------FLRQSHH--------PPTGGAA----------VTGDASHDEYYS-------
KAFR0G03690        --------NFLKDTIA------------------------------HDAKYQS-------
ZYRO0D09988g       -------GTFLTQVVNSDGANLLDVADRAEKSPSIKSSSRASARKSHLGEFAS-------
KNAG0A07940        ---------------------------------------------------SS-------
Kpol_480.14        ------SHSMLKKVVS----------------------------RDHNVEYVS-------
TPHA0D04250        --------TFLTRHIS---------------------------RKSENTEYIS-------
TDEL0D05600        -----------KKKEE---------------------------EDVGERDYVS-------
KLLA0D16236g       D--LTNSNSILKRVTT-----------KQQQ----------HQEELDDNEYHS-------
SAKL0F02772g       --------NFLRKVVT--------------N----------KKKEEEEKDYSS-------
KLTH0F14828g       -------KGFLHKVVS---------------------------KEQEQSAYNS-------
Kwal_55.21229      --------GFLRKVVT---------------------------KEQEDATYSS-------
CAGL0I10516g       TGFVSPFRRGLTSASAAASVSASASASRHRR----------FSNDSSDSDSDSRDAHNAA
Suva_7.418         ----EKPYQFLQKVVS--------------------------NEPKGKEDWVS-------
Skud_7.441         --QEEKPYQFLQKVVS--------------------------NEPKGKEEWVS-------
Smik_6.226         Q--KENPYQFLQKVVS--------------------------NEPKGKEEWIS-------
YGR130C            Q--QESPYQFLQKVVS--------------------------NEPKGKEEWVS-------
NDAI0G00940        R--PRSSSLFLQRVISSTSS-IQKTPTTSSS----------SKKKVSTEEYLS-------
NCAS0E00810        SMAPRTTSSFLQRVVSTTSSTTQKQPKKKIA----------ASEAKAMSDYAS-------
KNAG0B00810        --------GSFRRAIG----------------------------TAATEEYVS-------
KAFR0C01960        ------KHQFLSKVNT-------------NK----------SKENDDENKYNS-------
                                                                               

NDAI0B05860        ------PFLCHQTPKVSISDVGHSGLVIDRVENLLTRINHSHSLTVNTSVYVYISFIPQL
NCAS0F03550        ------TFREPLMNNR------------YYANYLYHMKQQRHPSLR--------------
TBLA0C04480        ------PFRDTQTP--------------SNMNVALKKKNHRYPTISATSPYSNMT-----
Ecym_1237          ------PFRDD-----------------KAVAEAERIRDLKFPTTGHHSTVRVKD-----
AFR310C            ------PFRDA-----------------IAVEEAHGSGTLKFPTTGTHVT----------
KAFR0G03690        ------PFRRNINP--------------NYLNYIREHKNAKYTITNPNSDFNKLN-----
ZYRO0D09988g       ------PFRLE-----------------SNEKDAEKRRLQRFPTVSPNSVFSKVH-----
KNAG0A07940        ------PISNP------------------------------------HSSYNTLK-----
Kpol_480.14        ------PFRDPSNV--------------QAANYAKAKKMERFPTVSASSHFSRMS-----
TPHA0D04250        ------PFRNPQDT--------------VRSNYAKSLKEKKFPTTSATSNFNKMV-----
TDEL0D05600        ------PFRDE-----------------QEVLSAQRRRTQRFPTTSAASAYVNAR-----
KLLA0D16236g       ------PFRTA-----------------EETQRARQVRQEKFPTLSQGA--VQLD-----
SAKL0F02772g       ------PFRSQ-----------------QELIAAKNVKAKKFPTVSATS--GTAS-----
KLTH0F14828g       ------PFRTS-----------------QSLAAAQKRKMQKFPTVSASV--SAHS-----
Kwal_55.21229      ------PFRTS-----------------QSQVEAQKRKVQRFPTVSASS--GGNS-----
CAGL0I10516g       SGGRSDSSRSDSSSDSDNEQKIAVNPFTNKPAYNKNAKQMKFPTVSATSALANQD-----
Suva_7.418         ------PFRQDALSGNQ-----------NNRLYVHDAKNRKFPTVSATSPYSKQQ-----
Skud_7.441         ------PFRQDALSRNQ-----------NNRLYVADAKNKKFPTVSATSAYSKQQ-----
Smik_6.226         ------PFRQDALASKQN----------NNRLYVEDAKNRKFPTVSATSAYSKQQ-----
YGR130C            ------PFRQDALANRQ-----------NNRAYGEDAKNRKFPTVSATSAYSKQQ-----
NDAI0G00940        ------PFRSNLVT--------------NNKAYIQNEKTKRFPTVSATSNYTNRT-----
NCAS0E00810        ------PFRAE-----------------YSNVNVQNEKTRRFPTVSATSNYTLKN-----
KNAG0B00810        ------PFRGGQLTK-------------ASKKQLQLQRTKKFPTVSATSLYNSYN-----
KAFR0C01960        ------PFRNNAPSR-------------EQKKQLQDLKTAKFPLVSATSTYNT-D-----
                         .                                                     

NDAI0B05860        KQSFFFCKIIS---VASRVPEGIIDRYHNPSFTTNQEKGSKHKMSVLTSKERSIAYQSDQ
NCAS0F03550        --------------KYESRNPNIVT----PEFLKGKEEKQKNDLFNLQMKEQNLQRLKNS
TBLA0C04480        PQDLGYKNI-H---PSTKRAKDIPF----PVLLIENEIRQDKLFAQLTEKESQLDYLQKS
Ecym_1237          --------------NVKRKAQDIAE----PRSFGTTDLKQQKQLDELGMKENQLEYLRNS
AFR310C            ----------E---EARRRVPDIDE----PKRLSTVDERQRQQLQELELKEGQLRLYKES
KAFR0G03690        LNTVGYKTI-PTDRKSRKIAKDIDF----PRSLRENEEAQTNFLNELKTKENNLKFLKDS
ZYRO0D09988g       PKELGYRTM-G---RGSRRAKDIQF----PIYLRENEARQDQLLTEVEIREQKLAYIKNS
KNAG0A07940        PEELGYKQ--K---FPKKYAREIHF----PAELTENEMRQRAILQDLDEKEQHLDHLKKS
Kpol_480.14        PNELGYKNI-S---KSTKRAKDISF----PSFLIANERRQGGIITDLELKEANLKYLRNS
TPHA0D04250        PGEMGYSSL-A---KNDKRAKDIQF----PKYLLDNEKRQAQLLMELQIKEHKLHELQKS
TDEL0D05600        PEELGYKKI-G---AGEKRAKDISF----PVYLEEIEKKQLELLRELEVKEAHLRYLKDC
KLLA0D16236g       PEQMGYSVVTD---KSVKKAKDIII----PSGLKDTEAEQKVRLTALEKKEKQLRYWRKS
SAKL0F02772g       AADLGYKVI-D---SAKRRAKDISV----PRYLKNTDEKQRKKLDKLEFKENHLQYLKDS
KLTH0F14828g       SSDMGYKVI-D---AARRRAKDIAV----PRYLQGNDERQRRRLDKLERKEDALKYKKDS
Kwal_55.21229      SAEMGFKVI-D---AARKRAKDIAV----PRYLQGNDERQRRRLDKLERKEDSLQYKKDS
CAGL0I10516g       PKELGFKTL-D---KSTKRAKDIKF----PVYLTENEFRQQTILKELELKEGKLQYLKDS
Suva_7.418         PQDLGYKNI-P---KDVKRAKDIKF----PTYLTKNEERQYQLLTELELKEKHLKYLKKC
Skud_7.441         PKDLGYKNI-P---KNAKRAKDIRF----PTYLTKNEERQYQLLTELELKEKHLKYLKEC
Smik_6.226         PKDLGYKNI-P---KNAKRAKDIRF----PTYLTQNEERQYQLLTELELKEKHLQYLKKC
YGR130C            PKDLGYKNI-P---KNAKRAKDIRF----PTYLTQNEERQYQLLTELELKEKHLKYLKKC
NDAI0G00940        SKEMGFKKI-P---KDKNFAKDIFF----PSYLTQNEQRQQIELTKLVKLEKDLQYKKDS
NCAS0E00810        PKQKGFTTI-K---KGQNFAKDIYF----PNYLTENEQRQQAELLILEKKEKDLKYLQDS
KNAG0B00810        TRELGFSKV-T---DDQRRARDIVF----PEYLLENEDRQRLILKDLEKREQTLLHLQRC
KAFR0C01960        TKDV-YKDL-D---PKKNFARDIKF----PSRLIDNENRQNQILLDLKIKQDALDRLKDS
                                         *      *      :  .   :  :   :  :      

NDAI0B05860        EHFDQFYDRYLAQINRQQQ------------VSQEKKSKENKQNVFSTQLRTNKENKKPN
NCAS0F03550        QRII---------------------------TSSTARTYPQQQNIYP-------------
TBLA0C04480        QKLIKVEPIGQRPV-----------------SKSKQKDSKLKTNTDKPKATKKTQSSISD
Ecym_1237          QKIVDVRKSSVGKGSEVGSVGEEATSALSGEGAMPVSAASDGKSFASDMKADKKSDVKSD
AFR310C            QKIVDVRGKSDVTQ-----------------RRAAQNTSKTSTTTGDKGALGDDDAVLVD
KAFR0G03690        QNLVYIDEDDISYEG---------------------------------------------
ZYRO0D09988g       QIVHDYTEGGKKKSGAKKGVKST--------KSKPSAKSPGKPAIKAVSKSNDELETIPD
KNAG0A07940        QRVVYI------------------------------------------------------
Kpol_480.14        QILLNENGTSTQTK-----------------ESSDEESSGDETSTDDATSTEASSTSTIT
TPHA0D04250        SRVLVLDEDK---------------------NELVLEESSSSDEEEESEEDDDDGDEGED
TDEL0D05600        QVVTEVKEKEKEKEK----------------EQPKVEDEADEYEAEEEADEEADANVGES
KLLA0D16236g       QKIVDLTKPQEAIEASDNLDELDEVDPS---KEPPIEDVAEALEEAEAMAEDDEEEPVDP
SAKL0F02772g       QKIVDVRKKNKEEQPAAVAAA----------TADAVEKPEGIEEVEDVGGSVGKEEITSK
KLTH0F14828g       QRIVDVRGGQDRAAG----------------AAEDEGDVATDAEVEAAADAETEAEADAE
Kwal_55.21229      QKIVKVKGEVGKSSTVETEPEAVE-------STKPVETEPEEAETTKPVETDEPVKPIET
CAGL0I10516g       QKIIDLTIRQPDSDE----------------EQQDEQDEQDDTEVEDNVDAENQQAHTKD
Suva_7.418         QKITDLTGDANDDTTSTTS------------SSSSLSSSDDEDTASATAPAENETATTAT
Skud_7.441         QKITDLTSDGNDDAATSADSSL---------SSSDKEDSTTSKGNEIAGEAAAADMTKIT
Smik_6.226         QKITDLTKDEKNDNGTATSSSMST-------SSSSSSSSSDDEGIASTTTTENNEAIANT
YGR130C            QKITDLTKDEKDDTDTTTSSSTSTSSSSSSSSSSSSSSSSDEGDVTSTTTSEATEATADT
NDAI0G00940        QNIIDLT------------------------KQPSQSQSPSPLD----------------
NCAS0E00810        QNIIDLTKKQEPKK-----------------APTPVASTTEEIDEATFPHSNISEEINPD
KNAG0B00810        QSVLDRT------------------------CKPAKEEKRKELKAIEPVKRDTTNRFAID
KAFR0C01960        LQVIDVEDL----------------------PRDDKEKGEEEKDSDPVPEQPSNNENITD
                     .                                                         

NDAI0B05860        KQFVSQFR-------------------------------------HNLIDNEFYENHLNY
NCAS0F03550        ------------------------------------------------------------
TBLA0C04480        KTSIAKLD-------------------------------------APKGKLKKEANTEEK
Ecym_1237          VKSDIRSA-------------------------------------GNLEEGSAVGQDTRE
AFR310C            YKSV--------------------------------------------------------
KAFR0G03690        ------------------------------------------------------------
ZYRO0D09988g       NEVGSQYTFETLPDGASYDYLIETEEVPAGAAHGKMSSKPVKLVRKGEKESKKEEATPDA
KNAG0A07940        ------------------------------------------------------------
Kpol_480.14        TEGSEEET-------------------------------------SNEQESTEIVSEEEV
TPHA0D04250        EDGDESVE-----------------------------------------EEKYVEEEEDN
TDEL0D05600        KAAASETE--------------------------------------PAADFKPIVPDVSE
KLLA0D16236g       KREPKPEA-----------------------------------ALRAFEEAEAIVQDDEE
SAKL0F02772g       EHSVPELT-------------------------------------SVEDTVEPTQELVEE
KLTH0F14828g       AHTQTDAG-----------------------ADAGVAASTAESVAASTKDAEAVPATIDE
Kwal_55.21229      GEPVKPIE-----------------------------------------TTEPVETDEPV
CAGL0I10516g       NDTITDKE----------------------------------------DMASQDAPEKEM
Suva_7.418         TTATSTTS----------------------------------AAGDSADEATSIEEEQKE
Skud_7.441         TTTAPTSS----------------------------------AVGDSGDEATSIEEEQDD
Smik_6.226         STTMTTST------------------------------STTSINEHGSDEATSIEEKQGD
YGR130C            ATTTTTTT-----------------------STSTTSTSTTNAVENSADEATSVEEEHED
NDAI0G00940        ------------------------------------------------------------
NCAS0E00810        YEDEEQSS----------------------------------------------------
KNAG0B00810        YDFVPPVD--------------------------------------------PTQEEKDE
KAFR0C01960        KDALQDAY----------------------------------------------------
                                                                               

NDAI0B05860        MRSQRHQSTTK-------------------------------------------------
NCAS0F03550        ------------------------------------------------------------
TBLA0C04480        PDIGSESEPES-------------------------------------------------
Ecym_1237          LASGTALDERS-------------------------------------------------
AFR310C            ------------------------------------------------------------
KAFR0G03690        ------------------------------------------------------------
ZYRO0D09988g       ESFNSKGPSPEPATPEAGLKSKAEEQAGNELKEVPETSSTSKKAESKVESSAKDVVGDEK
KNAG0A07940        ------------------------------------------------------------
Kpol_480.14        ATIENVSSAGS----------------------------------------VDQETIENE
TPHA0D04250        NAEE--------------------------------------------------------
TDEL0D05600        PVVPAVSEPAE------------------------------------------HEPEVSE
KLLA0D16236g       PPVDPEAEPSA---------------------------AVAVEALEEAEAIAQGQVPPRV
SAKL0F02772g       PVGELVQEPVE--------------------------------------------DLVQE
KLTH0F14828g       TPVSDTQDYVT-----------------------PGAEAPDAESGIAEPETSAAIAESEV
Kwal_55.21229      KPIETTEPVET-----------------------------------------TEPIETTE
CAGL0I10516g       SPREDSLPHPD-------------------------------------------------
Suva_7.418         NAGETTPTVET---------------------------TADNEKEIQEPETFKDEQNLAE
Skud_7.441         KASETTSVEKA---------------------------------------AAGNGEGAQE
Smik_6.226         KASESTSIEES----------TSKNDNNVREAASLNDEGNVAESSISKTTADSTQMNVPE
YGR130C            KVSESTSIGKG--------------------------------------------TADSA
NDAI0G00940        ------------------------------------------------------------
NCAS0E00810        ------------------------------------------------------------
KNAG0B00810        IDVSDPIVREY-------------------------------------------------
KAFR0C01960        ------------------------------------------------------------
                                                                               

NDAI0B05860        ---------------------------------NQLQNKEKITPNFLIENDSKQHRILQD
NCAS0F03550        ------------------------------------------------------------
TBLA0C04480        -------------SFVDAVSDQDITENLTRKSDGLAQSNVQEDDQIDTEIEDDSQDAQSW
Ecym_1237          ---------------------------------EISEAPTKVSGLKSAVSDGGQTASSVA
AFR310C            ---------------------------------LIVYPSGTYDGAYGPVTDRLGGDAKAT
KAFR0G03690        ------------------------------------------------------------
ZYRO0D09988g       AEKAEKTENLLDRSEPLDAAKDSADKATRFKEGPVEKIPDTVIGDETLEIAPEKGAHGAA
KNAG0A07940        ------------------------------------------------------------
Kpol_480.14        PTSTSLEADTVNQVIEEDRSQASITK-------AVEEPESATSTGAQNELETEEGEVNAP
TPHA0D04250        ---------------------------------NISEKIESIIGELDSQNENVSKNAEIL
TDEL0D05600        PVLAADSEPVVAAVSEPVVPAVSEPAG------REPEASEPVVSKTSLEVTTEVEPAEVS
KLLA0D16236g       PLAEEEEQENPTGVYKAPEDDANEYVDPSREARPESAVRAFEEAEAIVQDDEEEPVDPKR
SAKL0F02772g       PVQENVDDLASFTPSNSSVGVFDSPTDEIVEAVPILEGSDHEGGTRETTADDELQDDEPP
KLTH0F14828g       PAAIAVTETPVDGAAAEPEVPVAAAAESEV---PAALPSSETAGAEPTETATVNSKEVAV
Kwal_55.21229      PVEATEPVAAAEPLTTTEPSETTEPIETTEPVQVTEPVESTEASKPIETTEASQPIESTE
CAGL0I10516g       ---AAETKIMQHKDIDAPKLQERKPTPDVDVAAEQAEEVAETDGDVDAKEVDAEAGAEAD
Suva_7.418         PAVAEITPVTARSDIPESAVAAASDDVPEVAVANTSDNVPEVTVAAASDEVPEEAVAPIE
Skud_7.441         PVALKNEGSVAEPTAVTTQVDVPEPA-------VTSQSNVPESAVLPTEESKSETSVVKE
Smik_6.226         PAATSQRDTSAQVVTSSNDASE-----------PHTKSESGISKSDIIPTEELKEETVVA
YGR130C            QINVAEPISSENGVLEPR---------------TTDQSGGSKSGVVPTDEQKEEKSDVKK
NDAI0G00940        ------------------------------------------------------------
NCAS0E00810        ---------------------------------------------------AQNNEQLVL
KNAG0B00810        -----------------------------------------------IRDARGIPRAEAN
KAFR0C01960        ----------------------------------------------------DLNSKAAT
                                                                               

NDAI0B05860        IITRETNFNHLKNLQKIISQSE----------------------------LESQDLTPTM
NCAS0F03550        --------------------------------------------------KVYYEHSKKR
TBLA0C04480        VPSDNVSVASSTSSSSIGEKPMALDLAPKIHTEVVQVYGAT---------TSTNSKSNSN
Ecym_1237          GEAGGASVAEVKSGVSEGKAGVV---------------------------NAGNAAAVAS
AFR310C            TQKDVSDVSVQAADKDSEEGKPLLERSSTK--------------------RAAETTERRH
KAFR0G03690        -----------------------------------------------------DSKYKII
ZYRO0D09988g       ADVKKGAKEAKKQSESDEGVVEATKVAAGEPESYEGAGVTENDSTPGPMVDDVHSDVSVT
KNAG0A07940        --------------------------------------------------DKPVEKEDVV
Kpol_480.14        IEGSDANTKSENVEEEPEEGEEEEGNEPHEETEDE---------------SVQETEEKSL
TPHA0D04250        EEQSNVVDTEASQHESKGESLDEE--------------------------EEEEDTEQDA
TDEL0D05600        KPTAKPADEPETEEVEGEKLIEDGVETPESP-------------------EKTEKTEKTE
KLLA0D16236g       EPKPEAAVRAFEEAEAIVQDNEEPPVDPEAEPSPEEAVEAFQEAE-----AIATENPEAI
SAKL0F02772g       IPKPDVIETTETHKTTTGKEDQAEQELEE---------------------GQADGLAHGL
KLTH0F14828g       GTAPDAASSVQKVPAGVDLVGEPAVAEAAGEQPAT---------------EGKINADGVP
Kwal_55.21229      ASQPTPTTKASPDDEGIVGESLVADASAAAET------------------PAAAETSATL
CAGL0I10516g       AEAKAADAVMDSEAEPESQEKMAPSVKDTSSALA----------------SEDLESYMTV
Suva_7.418         EQTEKTSVVKTDTVTKEGKGEVADVEEETEQSSADEHGEETSTP------ETSEAESDGD
Skud_7.441         VNPTEEGQTEEVHDEEDEKSEQSSVEEHGEETSTP---------------ETSEAESVED
Smik_6.226         KKISSAVKSTEEEEGEGEETEQSSVEEPGEETSTP---------------GTSESESEED
YGR130C            VNPPSGEEKKEVEAEGDAEEETEQSSAEESAERTSTP-------------ETSEPESEED
NDAI0G00940        --------------------------------------------------DSANAEKPPL
NCAS0E00810        VQS-----------------------------------------------EEEIHTPNVV
KNAG0B00810        GGDASGDASGYDYDRDVLNIEQNQLVDAQ---------------------QMALQNEIEW
KAFR0C01960        KTDPDIVSHNYSVLNKNNLIDAK---------------------------DMSIENKLFY
                                                                               

NDAI0B05860        QKIKDSKIYPK-VYYKN-------FNMTKHP----PNINQQLSQNQK------------I
NCAS0F03550        TPPTEQEQFHR----------------------------GMNPPSPK-------------
TBLA0C04480        TREPTPSRSTS-SFFTV-------FKRNSNR----DQY-SNSPSNQRNVNSNLTNIKTST
Ecym_1237          DVPPTKQKGHR-GPFKF-----------SKK----GIF-ALWKRSEK-------------
AFR310C            SAGPLSNIMSH-MPFKL-----------QKG----GKLGGLFKHHDK-------------
KAFR0G03690        EKPINIYSVPK-IPS--------------------YVF-TKVPGNKK-------------
ZYRO0D09988g       SPPVDYAAVPRVVTFPE---------VEKKR----SIF-SIFGRKKK-------------
KNAG0A07940        REPVDIQKVPK-IPYSE------------------------YGQCNE-------------
Kpol_480.14        VEPINPDEAPM-LHMGP------PQPQSSST----GIM-AIFKGNSS-------------
TPHA0D04250        VGPIDPSIVPM-VRIPPICTDLLSAPKTNAT----FSIKSLISGAKGSNKTAKAGASNMT
TDEL0D05600        KPLPDPRSVPM-VALPA-----------APR----AFLDKIFKSPPA-------------
KLLA0D16236g       SPPPDINSAPR-VPFTPSGANKAGTAAATSGIAASGLF-ALFKRSKKPESSTKVAANAAA
SAKL0F02772g       AQPIDPNKAPR-VPFKA----------------KTGVF-ALWTRSDK-------------
KLTH0F14828g       EKPKDIKETPR-VPFAT------------------GIF-ALWTRSDK-------------
Kwal_55.21229      QKPKNIKDTPR-VPFAT------------------GIF-ALWTRSDK-------------
CAGL0I10516g       ETPQPYDKVPR-IPYTE---------QPESG----KKFSSFFKRNDN--AGHPVITDVPV
Suva_7.418         ITPIDPSKAPK-VPFQE-------RPQKERT----GFF-ALWKSPTS---------SSAK
Skud_7.441         KAPIDPSKAPK-VPFKE-------RPKKERT----GIF-ALWKSPTS---------SSAQ
Smik_6.226         KVPIDPSKAPK-VPFQE-------RPRKGKT----GIF-ALWKSSTS---------SSAQ
YGR130C            ESPIDPSKAPK-VPFQE-------PSRKERT----GIF-ALWKSPTS---------SSTQ
NDAI0G00940        EKPIDPKLTPM-VSFQL------------------STP-PVNNKNKK---------TQVV
NCAS0E00810        EPPIDPALAPM-VPFSL----------------------ATPNQKSK-----------KE
KNAG0B00810        RKPVDPATQPK-LYVDL------------------DSLQLIDPGSTA------VGVSTKQ
KAFR0C01960        LKPIHRKDYPK-VQSTT-------------------------------------------
                                                                               

NDAI0B05860        YPPFNPQLNPIATTTNPEILIKLNDDKT---IITKQTYDKLLELNQDHANWMINNNGESS
NCAS0F03550        --------YPIATPQNPEILVQLTENQNK--IVSKETYDRLVQVQSEHDAWLKSYNAENM
TBLA0C04480        LREMNNVINPKATPKNPELLVKTRYNNNSI-ILSKSVYDLVNYNIKVHNKRVKDYINDSN
Ecym_1237          ------PEKLNATPEDPEFIVLTEK-G----YMSKNIYDRLEYEEELHQEKLASLDQNSA
AFR310C            ----EQLLVPNGTPEEPEVVLLTNR-G----YMSKAVYDRLNDEEKAHLGRLVNSDEDAA
KAFR0G03690        ----KELKNSLATPQNKEQVIVLRKKDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGD
ZYRO0D09988g       --SQNRAPNPLATPENPEILVKTDREG----FLSKAVYDKVKYENHKHSEWLTEFISSEK
KNAG0A07940        ----AEFRNPVATPETPEEVVIYKHLNGTNKAYSKEIFDNIQRDICNHNAWLLSREGKAN
Kpol_480.14        SNIQPVSKNPMSSPENPEYVIKTKQHG----YLSKAVYDKVQYDQSVHQRWLDNLETTEE
TPHA0D04250        LGVAVPETHAVASPENPEYLVRTNEYN----IVSKAVYDQMNYEQKLHSEWLKNFNAAED
TDEL0D05600        -----PVPNPPATPENPEHVVKTKD-G----YLTKVIYDKITLQDRQHNEWIAKYKKDEQ
KLLA0D16236g       GTVVPGDDAPVATPEDPELIVRTQE-G----YVSKSVYDKLQYDEDQHQAKLALYSKEQD
SAKL0F02772g       ------QDQPLATPQDPEYIVRTDK-G----YMSKAIYDKLEYDEQVHQNELATFNKEQA
KLTH0F14828g       ------RGQPVASPNDPEFIVKFDK-G----YMSKALYDTLEYEEAIHKREMDDYTKEHD
Kwal_55.21229      ------RGQPVASPDDPEFIVKFDK-G----YMSKALYDTLEYEEAVHKQEMDQYTKENT
CAGL0I10516g       IPDQSQLDFPIATPENPELIAKTEEYG----YMSKPIYDKVVYDETNHRRWLKGFKKSEK
Suva_7.418         KGAATAPLNPVATPENPELIVKTKEHG----YLSKAVYDKINYDEKIHQAWLVDLRAREK
Skud_7.441         KGGVTAPSNPVATPENPELIVKTKEHG----YLSKAVYDKINYDEKVHQAWLADLKAKEK
Smik_6.226         KSNTAAPSNPVATPEKPELIVKTKEHG----YLSKAVYDKINYDEKVHQAWLTDLRAREK
YGR130C            KSKTAAPSNPVATPENPELIVKTKEHG----YLSKAVYDKINYDEKIHQAWLADLRAKEK
NDAI0G00940        PEEEEKERNPKATPNSKEEIVKTKKFG----ILSKSIYDQLQYDQQQHEQYLASYKAEMQ
NCAS0E00810        TEAPEKPSNPVASPTNQEEIVKTAQFG----YLSKAVYDKIQYDEQQHKKWLADYETKQN
KNAG0B00810        RLMDTPVTNPQATEDTPELLLKLPKYG----HVSAAVFNKVLYDDKVHKAEMADYQREQE
KAFR0C01960        -----ESKFPVASPENKETVVKLTSGK----KISKYVYDKIEHDTKVNDQYIVKYQNDQL
                              .:    * :             :   :: :      :   :        

NDAI0B05860        NLYNTKFKTYQEKLNKLNEQINHHNLIISMIKKDTLKNKELNDAILTNKRFQLFSLLNHE
NCAS0F03550        ANYNQRHQWYQKQIDVLDEKIRYYQEMSNVLEADYLRVSEINKNKALVKRFQINKLIGEE
TBLA0C04480        IKYKEKNEEFNNSINELDLKIKSIEKDIIDYKAKIDS---LMNDNVEKNDIDIENYH--E
Ecym_1237          AKYEDTARAYEEKLASLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLMDIQAKHDEQ
AFR310C            QDYQLVSQHYEKEIADLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAENADK
KAFR0G03690        ERHASKINEYDTQVSNLNTKIDIENEKIRKLNSKISHFKDFSDFKSTKNYLFKMTEYNNT
ZYRO0D09988g       KRYEEKQVDYDNRLEELKKEVEKLEESMQEIKDDANELIEIRHGRLSKKFLESTQQYIEK
KNAG0A07940        DQCATKMEEYNKQLAVLDDQIKSEKAAMNNLRRKQQRAIDLNENRLTKTFLLQTQQFTAE
Kpol_480.14        EKYQNKKTEYEDNLADIQSKIDNIHDLMDELKLKTSQKIEVMEYQLVKNILDMTQTHNDS
TPHA0D04250        EKYNTKKQEYEDKLVELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVD
TDEL0D05600        QKFDDKRAESNRKINSLRAQIKEIKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQK
KLLA0D16236g       ERYETKAQEYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINA
SAKL0F02772g       DKYDATEKEYNDKLTLLQSQIDELQATMEQLRLDTKEKIKVSESELSKKMLDLNATHISS
KLTH0F14828g       AKYEAKANEYEDRLTSLKSQIAELEATMETLQKDTTEKIEISEAKLSAQMIDLNAEHSSS
Kwal_55.21229      DKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDTTDKINISAAELSARMIESNAKHSNT
CAGL0I10516g       AKYDDKMEEYNNELEELQKEIDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQ
Suva_7.418         AKYDAKNTEYKEKLQDLQNQIDEIENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNK
Skud_7.441         AKYDATSTGYSERLQDLQNQIDEIENSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNK
Smik_6.226         AKYDAKNKEYEEKLQDLQNQIDEVEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNK
YGR130C            DKYDAKNKEYKEKLQDLQNQIDEIENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNK
NDAI0G00940        EKYDVKMQEYENELKSLDEKIVASNELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDD
NCAS0E00810        EKYEAKMQEYKKSLQDMDNQMSELNDLIEKCELDTKEKIDVMHGQLVKKVFDKKGVQIND
KNAG0B00810        SKFAKKLQEYEQKLAQVDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDS
KAFR0C01960        NKLNKLKSEYNEKIKSIQLEKFKTLNEIENLNLESFNNFEVIQNKLVKNLMDSTATFSDN
                             .  :  :                .                          

NDAI0B05860        KYVLNNNKLALC-------------------DQLDNTELLQRHIKDPKDSLQQKLKD---
NCAS0F03550        KILLMKNRNYLQTEIIKLKEQEEREKEKAEGKEIQPLGTEQAGITKA--ECTSSISSTSS
TBLA0C04480        KMLIKKNQIIKKNDEITYILQSSPPTAAIS-LDTKDAVTKQSDCTPLIKDWKSEQSKLNE
Ecym_1237          KETLLKEAENEKNAKITEKNTINEKLTQVE-PELEALKRLELERKVELQQYQSEVQALTA
AFR310C            QHVLHEQAEAQRAEQLADKEEIVHQNQELQ-PEIDRLRKLKENTAVEITECQARIDQLQQ
KAFR0G03690        KTRLYGEIEAIKNQR---------------------------------------------
ZYRO0D09988g       KNAIFHETKAIQDQKDKETDEIKHRQEEVQ-KEIAALNAEKDNIHREFIGWTNRLADYSA
KNAG0A07940        KNKIYKETERLN------------------------------------------------
Kpol_480.14        KNKIFKETELMKLEKLNAKQDFISKQAEIR-KEIENLSEEQTGVTDDFNEWNSKLNEITA
TPHA0D04250        KGKVIKETELMKLQKINAKEDLLAKQLDVK-NEIEKLNNEKEAITNEYNIWNGNLENLTT
TDEL0D05600        KNQVFKDTEVIKSQKLSEKDSVLDKQGEVQ-KEIDELNIEKEKVEEECQKWTKDIEELSA
KLLA0D16236g       KGDLYKQTEEIKNQTISDKEDKEVAHQTVQ-SEIDELLLLKDEVAKENQEHESKVEELTA
SAKL0F02772g       KNVIFKETENIKTQKIAERDEITAKHEEVK-AEIEELNVLKKQVDAEFNEYQAKLDDLTA
KLTH0F14828g       KNVIFKETENMKAAKVEEKEGVEAKQEDVK-TELEELEKLRAEIDAENREHQGRVDELTA
Kwal_55.21229      KNVIFKETENSKAAKIDEKAAVVAKQDEVK-AENEELEAQRAEADATNQELLSRIDELTT
CAGL0I10516g       KNKIFKETENIKNQKIQQKKEILDKHAVVQ-DEITQLNDRKKEVREEFDKWTTNMTTLGQ
Suva_7.418         KLMIFKDTENMKKQKLEEKNEVLNKQTNVK-SEIDELNSEKSNVQKEFNDWTTNLSSLSQ
Skud_7.441         KLMIFKDTENMKNQKLQEKDEVLGKQTAVK-SEIDELNSAKTNVQKEFNDWTTNLSNLSQ
Smik_6.226         KLMIFKDTENMKNQKLEEKNVVLNKQTNVK-SQIDELNSEKTNVQKDFNDWTTNLSNLSQ
YGR130C            KLMILKDTENMKNQKLQEKNEVLDKQTNVK-SEIDDLNNEKTNVQKEFNDWTTNLSNLSQ
NDAI0G00940        KMKIFSETKLIKREKIDEKINVEELDDQVV-GEIDQLNKEKEKVYDEFNEWTFNMTNIAE
NCAS0E00810        KMKIFNETKQIKLEKLSEKENVLNDNTEVK-QTIDELTNEKNKVRSEYDNWTTNMTNIGS
KNAG0B00810        KVKVLHEAQLVKLQKLQDLKFISQKKTLMQ-HEVNQLTLEKSHAEKDYHLWTTNLTNITE
KAFR0C01960        KVKILRKTGQLKLQKLNELKFLNQKRNLIR-REANMINVEKDSYKTNFNYINCSLNEILQ
                   :  :  .                                                     

NDAI0B05860        --NDRKRKATQLKNKRESVCDSSTSSICSSHQKDNKDSLNERVKEKDKNTQINAT-----
NCAS0F03550        ESSPSCASCHSKEQPGTEPIVEKSTIEPAEEKNVTE------------------------
TBLA0C04480        QIDSKVNVIKQLNKNLADVKQKITELSESAKPAPPLSPVKKLVSSPTTNTNTNVSSNAKA
Ecym_1237          ELDARLGELQNVSDEQTEVNLSMAALEERRVQIEKDISESNAVVANNKELLQNL----EN
AFR310C            QLDAQSRELRLVTDQQAEVSVVLATLQEQKAQLEREVADSNEFTKRNREALERLN-QTDY
KAFR0G03690        ----------------------------------NQLEQNQPVAVKPKKVDEPIN-RR--
ZYRO0D09988g       HLDAKMYSLHTLQQKHTKTQAQIDELSHKKAVLEKEMAAHKETHAKNTKAVEKHA-NKEY
KNAG0A07940        ------FAIRKHQDKN----------------------------------------RQGI
Kpol_480.14        QLDAKIEDIRAKNQQKLDIEQEMAKLNISKMELEEEIKKNEEIHKNNTELLTDLNVRKNY
TPHA0D04250        LLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDY
TDEL0D05600        RIDAKVADLEEVNVKQKNTQEEINKLQQQKVDILDQIEKNNLTHAENEKVIEGAK-NKTY
KLLA0D16236g       ELDNKTSALNESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIESID-NKEY
SAKL0F02772g       QLDSKVEKIQELNDKQMEITGLIAELNQKKLEIETETRDAEELHKESTGILESIK-NKEY
KLTH0F14828g       ELDAKLAAIQELNTQQAELQASIDDLQQQKDALISEANAADEQHGSNVAVLESIE-NKEY
Kwal_55.21229      QLDSKQSAIQELNDQQAEIQASIDALEQQKDTLVADATAADELHNSNIAILEGIS-NKDY
CAGL0I10516g       QLDAKIMKVTQITMKQDETQKEIEKLETQKKEYQAQIDAAKKEHEEGQKVVESYE-NKEY
Suva_7.418         QLDAQIFKINQINLKQSKAQNEIDNLEKQKKDLITQTEENKKLHEKNVEVLESVE-NKEY
Skud_7.441         QLDAQIFKINQINLKQSKVQNEIDALQKKKEDLIAQTEENKKLHERNVQTLESVE-NKEY
Smik_6.226         QLDAQIFKINQINLKQSKVQDEIDSLEQKKNALVTQTQENEKLHEKNVQVLESVE-NREY
YGR130C            QLDAQIFKINQINLKQGKVQNEIDNLEKKKEDLVTQTEENKKLHEKNVQVLESVE-NKEY
NDAI0G00940        QLDAKLFKIKQINITQMNLQNKIDGLNNEKLGLTKEIEANKFTHANNVETIENVD-NKQY
NCAS0E00810        ELDAKLFKISQINVTQMNLQNKIDALTSQKNNLQDEIAKNKNIHDSNVKLVESVD-NKEY
KNAG0B00810        RLDAQLFKLSQFNHKQDKITRQIRDLTQRKTELEAEIDANQFSKGNADRNLADLE-TGQH
KAFR0C01960        ELDAKLFKLSQDNIRNENLEHEINKLQSKKQTLLDEIDSIEYKKLHPDDDSKQL------
                                                                               

NDAI0B05860        ----KLKNREATVCN--SSSSSVCSSYQKKQGNLGSTTADQRHEMEVNDSELEPEPVVRT
NCAS0F03550        -P-------------------IVEPTKGNDKEPAIEMNEESNVETKKNDRLFEISSNENE
TBLA0C04480        TA--NTNTASNASIHSGSSRSTITINSNDELGGDLETAISTMDQPVVNSRQLNPSSSTPA
Ecym_1237          HP--SIAALDNQVSEVTRTVSAVEQEHAAQKDELTELSTKKEPTLSAVNPPKMVEE----
AFR310C            TA--TVREIDAKNSEILTEIAKIRQEIEFQRKELVALKERPQRTAASSFQGVATAVPVAR
KAFR0G03690        -----------------SKLYEIKTDDVEEGGNL--------------------------
ZYRO0D09988g       LP--KVHEIDDKISNLLGELSVIKQESANEKLKLGSITKKLESERQAHEEQLKLEAEERE
KNAG0A07940        LP----------------------------------------------------------
Kpol_480.14        LP--RINEIDNEIAGRLEKLSTIKKETIEENNRLTILTKKLEDERIARENEIRLKNEKLK
TPHA0D04250        LP--RLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIAHENEIKMKNEKMK
TDEL0D05600        LP--KLNEVDNQISVLLGQLTTIRQHCANERTELSAITKKLDKERLEHEEKLKLEAENRR
KLLA0D16236g       LP--KVNEINTEISSLLASLGLIQQEIANQKVEFSSVTRRLEEERKQHEEQLLKEKEERE
SAKL0F02772g       LP--KINAIDSQVATLLGSLTLIKQENANQKTEFAAITKRLEEERKAHEEKLRREEEERK
KLTH0F14828g       LP--KLNAIDTKISELLTSLTVVKQETANHKTEFAAVSKRLEEEDEERKEKLRQEEENRK
Kwal_55.21229      LP--KINALDSQISQLLSSLALVKQETANQHTEFAAVSKRLEEENEERKEKLRLEEENRK
CAGL0I10516g       LP--KIHTIDNQISELLNELAIIKQENANEQTELSKITKELEEERRAHEEKLKLEAEERE
Suva_7.418         LP--QINDIDTQISTLLNQMTIIRQENANERTHLSAITKKLEDERRAHEEQLKLEAEERK
Skud_7.441         LP--QINDIDNQVSTLLNKMTIIRQENANEKTELSAITKRLEDERRAHEEQLKLEAEERK
Smik_6.226         LP--QINDIDNQISTLLNEMTIIKQENANEKTQLSAITKRLEDERRAHEEQLKLEAEERK
YGR130C            LP--QINDIDNQISSLLNEVTIIKQENANEKTQLSAITKRLEDERRAHEEQLKLEAEERK
NDAI0G00940        LP--KLNNIDSQINDLLNQLTLIKQENANEKIQLSELTQKLEKERMDHEEKLKLDAEERK
NCAS0E00810        LP--KLNDIDNEINGLLNQMTIVKQENANEKVQLAEITKKLEDERRAHEEQLQLEAEERK
KNAG0B00810        LKSHELVKVTDSIQGKLDSLAVVKQEISGERLKLIGITNEMERARAERERIWNEKLDSNT
KAFR0C01960        ----ELNEMDEQINSKLSNLNLIKQEIINEKLKISKLTNDLNLQLIENKN----------
                                                                               

NDAI0B05860        IEKNERLFEVKTNEQEDMENNDNDNDDDDDD-----------------------------
NCAS0F03550        QGEND-------------------------------------------------------
TBLA0C04480        PIPKTPINTELEKSIKLQVSNKLKIKESLKNERLNLNTLISRLKDLT-------------
Ecym_1237          -IDVQEISELPDDVIVPEELDRLLHSSKQKPLGNPFTSHDGDSLD---------------
AFR310C            HGTND--------VKPFATASADPNSSALKNLSSG-------------------------
KAFR0G03690        ------------------------------------------------------------
ZYRO0D09988g       RKEKDLLGKQREEHEAVAAGLKKQHEEELRKMKQDYEKRLQELKEHQSKQTAEAEATKAR
KNAG0A07940        ------------------------------------------------------------
Kpol_480.14        REQEQKLQKQLAELKAK-------HNEELLEIQKKY------------------------
TPHA0D04250        REQDELLQKKLTELQEK-------HNEEMAEIQKKYQEK---------------------
TDEL0D05600        RKEEDLLGKQRKELEAKAQEAREKHEQEMQKLKTDY------------------------
KLLA0D16236g       RLEKERLEKQRTEYEKQAEEARLKHEEELANLKQTHDEALKEAQLQREAAAKQLEEEQQR
SAKL0F02772g       RLEEERLQKQREELEAKAEDARLKHEEELRQIKEEHEKALNDANV-------QLAKEKEE
KLTH0F14828g       RLEAERLQKQREEHDQQILLLQQEHERQLAEASQKAAEHEQALLKEREQ-----------
Kwal_55.21229      RLEAERFQKQRDEHDQHVLTLQQEHERQLAEASQKAADTELLLQQEREK-----------
CAGL0I10516g       RQEKNLLEKQRLELEEKAEQQKREHEEQVRKMKEQYENE---------------------
Suva_7.418         RKEENLLEKQRQELEEQAHQAELEHEEQITQVKKTYNDQLTELQD-------KLAAEEEE
Skud_7.441         RKEENLLEKQRQELEEQAHQAQLDHEQQITQVKQTYNDQLTELQD-------KLAAEEKE
Smik_6.226         RKEENLLEKQRQELEEQARQAQLDHEEQITQVKKTYNDQLTELQD-------KLAAEEKE
YGR130C            RKEENLLEKQRQELEEQAHQAQLDHEQQITQVKQTYNDQLTELQD-------KLATEEKE
NDAI0G00940        RQEENLLGKQREELEQKANDLQLNHETEMTNLKTSYEQQLADFKS-------KLMEQQDK
NCAS0E00810        RQEENLLGKQRDELEAKANTMQVNHQQEIDALKNDYETKLEEFKN-------QLKQEQDQ
KNAG0B00810        KFYEDKLGEKDADLDERLKQLDVEHTANLVQVREIYEAKLQDSAEKAEEAEQQLKLAAEE
KAFR0C01960        --ENLRIMDENTKLNDKIHNMQELHKNELKNLTERHENS---------------------
                                                                               

NDAI0B05860        ------------------------------------------------------------
NCAS0F03550        ------------------------------------------------------------
TBLA0C04480        -------------------------KNYSVKL--SSTLSSASSINSMPINSSSETSSLTE
Ecym_1237          -------------------------FTHVPAS--AKADNGEVKISLDPNAESKKPVNLSS
AFR310C            ------------------------------------------------------------
KAFR0G03690        ------------------------------------------------------------
ZYRO0D09988g       AAENETHGGVATHSVKSSGASGASGTDGIKST--GAKSTGAKSTGAKSTDAKSTGAKSTD
KNAG0A07940        ------------------------------------------------------------
Kpol_480.14        ----------------------------------------EKKMAQQPKA----------
TPHA0D04250        ------------------------------------------------------------
TDEL0D05600        -----------------------------------TQLEGKFKREQQQKKDALAFA----
KLLA0D16236g       -------------------------REQVERE--RTRLQGEKAIEAQQRGNPEDKRLEAE
SAKL0F02772g       -------------------------REVVERE--KTRLAGEKAIQEQERAQEADLALKQE
KLTH0F14828g       -------------------------RELVERE--RVKLQGEKAIREQEEAKAADKALEEE
Kwal_55.21229      -------------------------RELVERE--RVRLQGEKAIQEQEQAKLADKALEDE
CAGL0I10516g       -------------------------LNNVKKQ--KESLETEKLVEEHNRNEN----IKKE
Suva_7.418         -------------------------LEAVKRE--RTKLQGEKAIEEQTRQKNADEILKQT
Skud_7.441         -------------------------LEAVKRE--RTRLQGEKAIEEQTRQKSSDEALKQE
Smik_6.226         -------------------------LETVKRE--KTRLQGEKAIEEQTRQRNADEALKQE
YGR130C            -------------------------LEAVKRE--RTRLQAEKAIEEQTRQKNADEALKQE
NDAI0G00940        -------------------------VDDLKLQ--KSRLEGSKAIEDQDRQKQSDNVLKNE
NCAS0E00810        -------------------------LDQVKRQ--KTRLEGEKALDEQKRQKDADDVLKNE
KNAG0B00810        -------------------------KAQIEKSLLDQEQQAKKELEDMQKERDFAERRAKD
KAFR0C01960        ------------------------------------------------------------
                                                                               

NDAI0B05860        ------------------------------------------------------------
NCAS0F03550        ------------------------------------------------------------
TBLA0C04480        LNDDTNIRRGTAHSIAVKQLHR--------------------------------------
Ecym_1237          LSSRPRNPPSIATTS---------------------------------------------
AFR310C            ------------------------------------------------------------
KAFR0G03690        ------------------------------------------------------------
ZYRO0D09988g       AKSTDAKPNATKSGVGATTKSTGPQATDSTSGKVHNPFTDSGVTKSKETRELTDNQGKPS
KNAG0A07940        ------------------------------------------------------------
Kpol_480.14        ------------------------------------------------------------
TPHA0D04250        ------------------------------------------------------------
TDEL0D05600        ------------------------------------------------------------
KLLA0D16236g       HEEKLRRQAEAASAVENALKSSNK----------------KTKAAVP-------------
SAKL0F02772g       LMEKRRKQAEAVDAAEQARKIST-----------------QKKSVLSNPS----------
KLTH0F14828g       IKQRNHSRALALDGAEAAVQKSQKEITEQKKTPLLPASEQKETPLLPAPVQ---------
Kwal_55.21229      VKERNHNRAQAIDAAEAARARNAKSISN------------NNAPALSTPKE---------
CAGL0I10516g       VLDKQRKQAEAQHAAQTKSIATNA------------------------------------
Suva_7.418         ILDKQHKQATGLHAAENRVNTPSSNLQESK------------------------------
Skud_7.441         ILGKQHKQAEGLHAAEKHNIPNSHSPKNE-------------------------------
Smik_6.226         ILSKQHKQAEGLHAAERYKIPNDHPQKNK-------------------------------
YGR130C            ILSRQHKQAEGIHAAENHKIPNDRSQKNT-------------------------------
NDAI0G00940        ILSKQHQQAEAYNAVQLAQKKK------------------NASPVAEDLMK---------
NCAS0E00810        IFEKQHKQAEAFSAAQLKGRKH------------------PLAALAREITG---------
KNAG0B00810        ESERADQHLEQKVAIEMERKEWAKKIADAEERANIATKARVNAQHERSNAESELTKARN-
KAFR0C01960        ------------------------------------------------------------
                                                                               

NDAI0B05860        --------------------------------DLYEYETKEEIVYV--------------
NCAS0F03550        --------------------------------SKYEILEEEEIKYI--------------
TBLA0C04480        ------------------------STIPGKYQQLIKIMVLPQLVYMLLQMMVMNILLCTI
Ecym_1237          ------------------------PGTAKGN-SEYEYETIEEVVIVEGDGTRSDSSRLIA
AFR310C            ------------------------PSTNKES-SLYDNETADEVIVTEGDSKPSRLIVLPD
KAFR0G03690        --------------------------------SVKEEEEEEEFVVV--------------
ZYRO0D09988g       GVVPYGSNVASGSTANDNRNTKQNPSASRES-SLFDYETEEEIRSVY-------------
KNAG0A07940        -----------------------------DD-ASHDTVTVEETVYV--------------
Kpol_480.14        ------------------------VELPTDN-SLYEYVTEEEVFSL--------------
TPHA0D04250        ------------------------------------------------------------
TDEL0D05600        ------------------------HEPTKDD-SLYEYGTEEEILTV--------------
KLLA0D16236g       ------------------------PANTTNS-SLYDYETVEEVITVD-------------
SAKL0F02772g       ------------------------QNLTRES-SLYDYETVEEIITVDE------------
KLTH0F14828g       ----------KETPLLPAPESAQPKALTNDNSSLYEYFTEKEIRTVNSSTSAFTKA----
Kwal_55.21229      ----------DEKLNI--------KDATTDN-SLYEYFTEKEVRYVNSNSSLLPQN----
CAGL0I10516g       ------------------------ANDMQDN-SLYEFKTEEEIMYV--------------
Suva_7.418         ------------------------RAVPKND-SLYEYHTEEDVMYA--------------
Skud_7.441         ------------------------ILVPKDD-SLYEYHTEEDVMYA--------------
Smik_6.226         ------------------------NVVPKDD-SLYEYHTEEDVMYA--------------
YGR130C            ------------------------SVLPKDD-SLYEYHTEEDVMYA--------------
NDAI0G00940        ----------ESHIPA--------LSKAKDD-SLFEYETEEEIMYV--------------
NCAS0E00810        ----------EAK------------PSSKDN-SLYDYETEEDVMYV--------------
KNAG0B00810        ------------------------KPIFENN-SLYSFATEEVTTFK--------------
KAFR0C01960        --------------------------------DTYSYVTEEQIQFQ--------------
                                                                               

NDAI0B05860        ------
NCAS0F03550        ------
TBLA0C04480        GSQKKS
Ecym_1237          VPLEQ-
AFR310C            N-----
KAFR0G03690        ------
ZYRO0D09988g       ------
KNAG0A07940        ------
Kpol_480.14        ------
TPHA0D04250        ------
TDEL0D05600        ------
KLLA0D16236g       ------
SAKL0F02772g       ------
KLTH0F14828g       ------
Kwal_55.21229      ------
CAGL0I10516g       ------
Suva_7.418         ------
Skud_7.441         ------
Smik_6.226         ------
YGR130C            ------
NDAI0G00940        ------
NCAS0E00810        ------
KNAG0B00810        ------
KAFR0C01960        ------
                         

FASTA FORMAT for MUSCLE Version 3.6

>NDAI0B05860
MRTAMAMAMAMAMAMVMGDVTCVLDIKGPSITTTAEMFGCLWKGGGGTKRGDTFRGDDPP
GMRGRERRGRLCRCVQ-------------------------KGGHPDNPDI---------
------PFLCHQTPKVSISDVGHSGLVIDRVENLLTRINHSHSLTVNTSVYVYISFIPQL
KQSFFFCKIIS---VASRVPEGIIDRYHNPSFTTNQEKGSKHKMSVLTSKERSIAYQSDQ
EHFDQFYDRYLAQINRQQQ------------VSQEKKSKENKQNVFSTQLRTNKENKKPN
KQFVSQFR-------------------------------------HNLIDNEFYENHLNY
MRSQRHQSTTK-------------------------------------------------
---------------------------------NQLQNKEKITPNFLIENDSKQHRILQD
IITRETNFNHLKNLQKIISQSE----------------------------LESQDLTPTM
QKIKDSKIYPK-VYYKN-------FNMTKHP----PNINQQLSQNQK------------I
YPPFNPQLNPIATTTNPEILIKLNDDKT---IITKQTYDKLLELNQDHANWMINNNGESS
NLYNTKFKTYQEKLNKLNEQINHHNLIISMIKKDTLKNKELNDAILTNKRFQLFSLLNHE
KYVLNNNKLALC-------------------DQLDNTELLQRHIKDPKDSLQQKLKD---
--NDRKRKATQLKNKRESVCDSSTSSICSSHQKDNKDSLNERVKEKDKNTQINAT-----
----KLKNREATVCN--SSSSSVCSSYQKKQGNLGSTTADQRHEMEVNDSELEPEPVVRT
IEKNERLFEVKTNEQEDMENNDNDNDDDDDD-----------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------DLYEYETKEEIVYV--------------
------
>NCAS0F03550
--------------------MITAKQRSQTIQLDQEHFDQFYDQYVTELNESRRR-----
-------GTHITQFNA------------VEN----------EESLTPNARFVS-------
------TFREPLMNNR------------YYANYLYHMKQQRHPSLR--------------
--------------KYESRNPNIVT----PEFLKGKEEKQKNDLFNLQMKEQNLQRLKNS
QRII---------------------------TSSTARTYPQQQNIYP-------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------KVYYEHSKKR
TPPTEQEQFHR----------------------------GMNPPSPK-------------
--------YPIATPQNPEILVQLTENQNK--IVSKETYDRLVQVQSEHDAWLKSYNAENM
ANYNQRHQWYQKQIDVLDEKIRYYQEMSNVLEADYLRVSEINKNKALVKRFQINKLIGEE
KILLMKNRNYLQTEIIKLKEQEEREKEKAEGKEIQPLGTEQAGITKA--ECTSSISSTSS
ESSPSCASCHSKEQPGTEPIVEKSTIEPAEEKNVTE------------------------
-P-------------------IVEPTKGNDKEPAIEMNEESNVETKKNDRLFEISSNENE
QGEND-------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------SKYEILEEEEIKYI--------------
------
>TBLA0C04480
---------------------MPSSLLSSNRHSKKNKLHHNSH--NKKRKNGNTD-----
---SVEPSDVLQTAIN--------------S----------HTLHGKGKQYKS-------
------PFRDTQTP--------------SNMNVALKKKNHRYPTISATSPYSNMT-----
PQDLGYKNI-H---PSTKRAKDIPF----PVLLIENEIRQDKLFAQLTEKESQLDYLQKS
QKLIKVEPIGQRPV-----------------SKSKQKDSKLKTNTDKPKATKKTQSSISD
KTSIAKLD-------------------------------------APKGKLKKEANTEEK
PDIGSESEPES-------------------------------------------------
-------------SFVDAVSDQDITENLTRKSDGLAQSNVQEDDQIDTEIEDDSQDAQSW
VPSDNVSVASSTSSSSIGEKPMALDLAPKIHTEVVQVYGAT---------TSTNSKSNSN
TREPTPSRSTS-SFFTV-------FKRNSNR----DQY-SNSPSNQRNVNSNLTNIKTST
LREMNNVINPKATPKNPELLVKTRYNNNSI-ILSKSVYDLVNYNIKVHNKRVKDYINDSN
IKYKEKNEEFNNSINELDLKIKSIEKDIIDYKAKIDS---LMNDNVEKNDIDIENYH--E
KMLIKKNQIIKKNDEITYILQSSPPTAAIS-LDTKDAVTKQSDCTPLIKDWKSEQSKLNE
QIDSKVNVIKQLNKNLADVKQKITELSESAKPAPPLSPVKKLVSSPTTNTNTNVSSNAKA
TA--NTNTASNASIHSGSSRSTITINSNDELGGDLETAISTMDQPVVNSRQLNPSSSTPA
PIPKTPINTELEKSIKLQVSNKLKIKESLKNERLNLNTLISRLKDLT-------------
-------------------------KNYSVKL--SSTLSSASSINSMPINSSSETSSLTE
LNDDTNIRRGTAHSIAVKQLHR--------------------------------------
------------------------STIPGKYQQLIKIMVLPQLVYMLLQMMVMNILLCTI
GSQKKS
>Ecym_1237
-----------------------MSSIFKKNKQP-DPFKELLD--NEEDKHGTTE-----
--------LFVKKVTN-----HRKASEDDGT----------QGNVEGGGEYVS-------
------PFRDD-----------------KAVAEAERIRDLKFPTTGHHSTVRVKD-----
--------------NVKRKAQDIAE----PRSFGTTDLKQQKQLDELGMKENQLEYLRNS
QKIVDVRKSSVGKGSEVGSVGEEATSALSGEGAMPVSAASDGKSFASDMKADKKSDVKSD
VKSDIRSA-------------------------------------GNLEEGSAVGQDTRE
LASGTALDERS-------------------------------------------------
---------------------------------EISEAPTKVSGLKSAVSDGGQTASSVA
GEAGGASVAEVKSGVSEGKAGVV---------------------------NAGNAAAVAS
DVPPTKQKGHR-GPFKF-----------SKK----GIF-ALWKRSEK-------------
------PEKLNATPEDPEFIVLTEK-G----YMSKNIYDRLEYEEELHQEKLASLDQNSA
AKYEDTARAYEEKLASLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLMDIQAKHDEQ
KETLLKEAENEKNAKITEKNTINEKLTQVE-PELEALKRLELERKVELQQYQSEVQALTA
ELDARLGELQNVSDEQTEVNLSMAALEERRVQIEKDISESNAVVANNKELLQNL----EN
HP--SIAALDNQVSEVTRTVSAVEQEHAAQKDELTELSTKKEPTLSAVNPPKMVEE----
-IDVQEISELPDDVIVPEELDRLLHSSKQKPLGNPFTSHDGDSLD---------------
-------------------------FTHVPAS--AKADNGEVKISLDPNAESKKPVNLSS
LSSRPRNPPSIATTS---------------------------------------------
------------------------PGTAKGN-SEYEYETIEEVVIVEGDGTRSDSSRLIA
VPLEQ-
>AFR310C
----------------------MSIALFKKKLKPADPFEELSGL-PEEKKKDPTE-----
---------FLRQSHH--------PPTGGAA----------VTGDASHDEYYS-------
------PFRDA-----------------IAVEEAHGSGTLKFPTTGTHVT----------
----------E---EARRRVPDIDE----PKRLSTVDERQRQQLQELELKEGQLRLYKES
QKIVDVRGKSDVTQ-----------------RRAAQNTSKTSTTTGDKGALGDDDAVLVD
YKSV--------------------------------------------------------
------------------------------------------------------------
---------------------------------LIVYPSGTYDGAYGPVTDRLGGDAKAT
TQKDVSDVSVQAADKDSEEGKPLLERSSTK--------------------RAAETTERRH
SAGPLSNIMSH-MPFKL-----------QKG----GKLGGLFKHHDK-------------
----EQLLVPNGTPEEPEVVLLTNR-G----YMSKAVYDRLNDEEKAHLGRLVNSDEDAA
QDYQLVSQHYEKEIADLDAEISKLRADITALQAETEGQIDGLEASLSKNIQDMKAENADK
QHVLHEQAEAQRAEQLADKEEIVHQNQELQ-PEIDRLRKLKENTAVEITECQARIDQLQQ
QLDAQSRELRLVTDQQAEVSVVLATLQEQKAQLEREVADSNEFTKRNREALERLN-QTDY
TA--TVREIDAKNSEILTEIAKIRQEIEFQRKELVALKERPQRTAASSFQGVATAVPVAR
HGTND--------VKPFATASADPNSSALKNLSSG-------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------PSTNKES-SLYDNETADEVIVTEGDSKPSRLIVLPD
N-----
>KAFR0G03690
----------------------MAVNYYAD-----DRFIEVLK--EQERAKNPHR-----
--------NFLKDTIA------------------------------HDAKYQS-------
------PFRRNINP--------------NYLNYIREHKNAKYTITNPNSDFNKLN-----
LNTVGYKTI-PTDRKSRKIAKDIDF----PRSLRENEEAQTNFLNELKTKENNLKFLKDS
QNLVYIDEDDISYEG---------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------DSKYKII
EKPINIYSVPK-IPS--------------------YVF-TKVPGNKK-------------
----KELKNSLATPQNKEQVIVLRKKDGLLYYFSKEVFDNIQYENKIHHDKLKKLNAKGD
ERHASKINEYDTQVSNLNTKIDIENEKIRKLNSKISHFKDFSDFKSTKNYLFKMTEYNNT
KTRLYGEIEAIKNQR---------------------------------------------
----------------------------------NQLEQNQPVAVKPKKVDEPIN-RR--
-----------------SKLYEIKTDDVEEGGNL--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------SVKEEEEEEEFVVV--------------
------
>ZYRO0D09988g
--------------------------MFRSKRP--DPFTGLYE--EAHRREQARK-----
-------GTFLTQVVNSDGANLLDVADRAEKSPSIKSSSRASARKSHLGEFAS-------
------PFRLE-----------------SNEKDAEKRRLQRFPTVSPNSVFSKVH-----
PKELGYRTM-G---RGSRRAKDIQF----PIYLRENEARQDQLLTEVEIREQKLAYIKNS
QIVHDYTEGGKKKSGAKKGVKST--------KSKPSAKSPGKPAIKAVSKSNDELETIPD
NEVGSQYTFETLPDGASYDYLIETEEVPAGAAHGKMSSKPVKLVRKGEKESKKEEATPDA
ESFNSKGPSPEPATPEAGLKSKAEEQAGNELKEVPETSSTSKKAESKVESSAKDVVGDEK
AEKAEKTENLLDRSEPLDAAKDSADKATRFKEGPVEKIPDTVIGDETLEIAPEKGAHGAA
ADVKKGAKEAKKQSESDEGVVEATKVAAGEPESYEGAGVTENDSTPGPMVDDVHSDVSVT
SPPVDYAAVPRVVTFPE---------VEKKR----SIF-SIFGRKKK-------------
--SQNRAPNPLATPENPEILVKTDREG----FLSKAVYDKVKYENHKHSEWLTEFISSEK
KRYEEKQVDYDNRLEELKKEVEKLEESMQEIKDDANELIEIRHGRLSKKFLESTQQYIEK
KNAIFHETKAIQDQKDKETDEIKHRQEEVQ-KEIAALNAEKDNIHREFIGWTNRLADYSA
HLDAKMYSLHTLQQKHTKTQAQIDELSHKKAVLEKEMAAHKETHAKNTKAVEKHA-NKEY
LP--KVHEIDDKISNLLGELSVIKQESANEKLKLGSITKKLESERQAHEEQLKLEAEERE
RKEKDLLGKQREEHEAVAAGLKKQHEEELRKMKQDYEKRLQELKEHQSKQTAEAEATKAR
AAENETHGGVATHSVKSSGASGASGTDGIKST--GAKSTGAKSTGAKSTDAKSTGAKSTD
AKSTDAKPNATKSGVGATTKSTGPQATDSTSGKVHNPFTDSGVTKSKETRELTDNQGKPS
GVVPYGSNVASGSTANDNRNTKQNPSASRES-SLFDYETEEEIRSVY-------------
------
>KNAG0A07940
---------------------MWSMLLGKKRK----------------------------
---------------------------------------------------SS-------
------PISNP------------------------------------HSSYNTLK-----
PEELGYKQ--K---FPKKYAREIHF----PAELTENEMRQRAILQDLDEKEQHLDHLKKS
QRVVYI------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------DKPVEKEDVV
REPVDIQKVPK-IPYSE------------------------YGQCNE-------------
----AEFRNPVATPETPEEVVIYKHLNGTNKAYSKEIFDNIQRDICNHNAWLLSREGKAN
DQCATKMEEYNKQLAVLDDQIKSEKAAMNNLRRKQQRAIDLNENRLTKTFLLQTQQFTAE
KNKIYKETERLN------------------------------------------------
------FAIRKHQDKN----------------------------------------RQGI
LP----------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------DD-ASHDTVTVEETVYV--------------
------
>Kpol_480.14
--------------------------MFKKRE------GIVID--DTETDGNRSR-----
------SHSMLKKVVS----------------------------RDHNVEYVS-------
------PFRDPSNV--------------QAANYAKAKKMERFPTVSASSHFSRMS-----
PNELGYKNI-S---KSTKRAKDISF----PSFLIANERRQGGIITDLELKEANLKYLRNS
QILLNENGTSTQTK-----------------ESSDEESSGDETSTDDATSTEASSTSTIT
TEGSEEET-------------------------------------SNEQESTEIVSEEEV
ATIENVSSAGS----------------------------------------VDQETIENE
PTSTSLEADTVNQVIEEDRSQASITK-------AVEEPESATSTGAQNELETEEGEVNAP
IEGSDANTKSENVEEEPEEGEEEEGNEPHEETEDE---------------SVQETEEKSL
VEPINPDEAPM-LHMGP------PQPQSSST----GIM-AIFKGNSS-------------
SNIQPVSKNPMSSPENPEYVIKTKQHG----YLSKAVYDKVQYDQSVHQRWLDNLETTEE
EKYQNKKTEYEDNLADIQSKIDNIHDLMDELKLKTSQKIEVMEYQLVKNILDMTQTHNDS
KNKIFKETELMKLEKLNAKQDFISKQAEIR-KEIENLSEEQTGVTDDFNEWNSKLNEITA
QLDAKIEDIRAKNQQKLDIEQEMAKLNISKMELEEEIKKNEEIHKNNTELLTDLNVRKNY
LP--RINEIDNEIAGRLEKLSTIKKETIEENNRLTILTKKLEDERIARENEIRLKNEKLK
REQEQKLQKQLAELKAK-------HNEELLEIQKKY------------------------
----------------------------------------EKKMAQQPKA----------
------------------------------------------------------------
------------------------VELPTDN-SLYEYVTEEEVFSL--------------
------
>TPHA0D04250
---------------------------MSKRK---DTFTVL----EDHPGQEPQQ-----
--------TFLTRHIS---------------------------RKSENTEYIS-------
------PFRNPQDT--------------VRSNYAKSLKEKKFPTTSATSNFNKMV-----
PGEMGYSSL-A---KNDKRAKDIQF----PKYLLDNEKRQAQLLMELQIKEHKLHELQKS
SRVLVLDEDK---------------------NELVLEESSSSDEEEESEEDDDDGDEGED
EDGDESVE-----------------------------------------EEKYVEEEEDN
NAEE--------------------------------------------------------
---------------------------------NISEKIESIIGELDSQNENVSKNAEIL
EEQSNVVDTEASQHESKGESLDEE--------------------------EEEEDTEQDA
VGPIDPSIVPM-VRIPPICTDLLSAPKTNAT----FSIKSLISGAKGSNKTAKAGASNMT
LGVAVPETHAVASPENPEYLVRTNEYN----IVSKAVYDQMNYEQKLHSEWLKNFNAAED
EKYNTKKQEYEDKLVELQKQLDDIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVD
KGKVIKETELMKLQKINAKEDLLAKQLDVK-NEIEKLNNEKEAITNEYNIWNGNLENLTT
LLDEKIAKIEAINENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDY
LP--RLNEIDEQIAAKFDKLAIIKNETISENNQLSILTKKLEEERIAHENEIKMKNEKMK
REQDELLQKKLTELQEK-------HNEEMAEIQKKYQEK---------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------
>TDEL0D05600
--------------------------MFKQKRS--DPFAQYWAGDQAKDVEEQQK-----
-----------KKKEE---------------------------EDVGERDYVS-------
------PFRDE-----------------QEVLSAQRRRTQRFPTTSAASAYVNAR-----
PEELGYKKI-G---AGEKRAKDISF----PVYLEEIEKKQLELLRELEVKEAHLRYLKDC
QVVTEVKEKEKEKEK----------------EQPKVEDEADEYEAEEEADEEADANVGES
KAAASETE--------------------------------------PAADFKPIVPDVSE
PVVPAVSEPAE------------------------------------------HEPEVSE
PVLAADSEPVVAAVSEPVVPAVSEPAG------REPEASEPVVSKTSLEVTTEVEPAEVS
KPTAKPADEPETEEVEGEKLIEDGVETPESP-------------------EKTEKTEKTE
KPLPDPRSVPM-VALPA-----------APR----AFLDKIFKSPPA-------------
-----PVPNPPATPENPEHVVKTKD-G----YLTKVIYDKITLQDRQHNEWIAKYKKDEQ
QKFDDKRAESNRKINSLRAQIKEIKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQK
KNQVFKDTEVIKSQKLSEKDSVLDKQGEVQ-KEIDELNIEKEKVEEECQKWTKDIEELSA
RIDAKVADLEEVNVKQKNTQEEINKLQQQKVDILDQIEKNNLTHAENEKVIEGAK-NKTY
LP--KLNEVDNQISVLLGQLTTIRQHCANERTELSAITKKLDKERLEHEEKLKLEAENRR
RKEEDLLGKQRKELEAKAQEAREKHEQEMQKLKTDY------------------------
-----------------------------------TQLEGKFKREQQQKKDALAFA----
------------------------------------------------------------
------------------------HEPTKDD-SLYEYGTEEEILTV--------------
------
>KLLA0D16236g
---------------------MVGLNLFRKRNEI-DPFAGLLD--DADHAAEQQQ---QH
D--LTNSNSILKRVTT-----------KQQQ----------HQEELDDNEYHS-------
------PFRTA-----------------EETQRARQVRQEKFPTLSQGA--VQLD-----
PEQMGYSVVTD---KSVKKAKDIII----PSGLKDTEAEQKVRLTALEKKEKQLRYWRKS
QKIVDLTKPQEAIEASDNLDELDEVDPS---KEPPIEDVAEALEEAEAMAEDDEEEPVDP
KREPKPEA-----------------------------------ALRAFEEAEAIVQDDEE
PPVDPEAEPSA---------------------------AVAVEALEEAEAIAQGQVPPRV
PLAEEEEQENPTGVYKAPEDDANEYVDPSREARPESAVRAFEEAEAIVQDDEEEPVDPKR
EPKPEAAVRAFEEAEAIVQDNEEPPVDPEAEPSPEEAVEAFQEAE-----AIATENPEAI
SPPPDINSAPR-VPFTPSGANKAGTAAATSGIAASGLF-ALFKRSKKPESSTKVAANAAA
GTVVPGDDAPVATPEDPELIVRTQE-G----YVSKSVYDKLQYDEDQHQAKLALYSKEQD
ERYETKAQEYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKLKQVEKSQALLETNVKHINA
KGDLYKQTEEIKNQTISDKEDKEVAHQTVQ-SEIDELLLLKDEVAKENQEHESKVEELTA
ELDNKTSALNESLAKKDETNAEIQALEEEKARLEQEIKEAQELHQQNVSKIESID-NKEY
LP--KVNEINTEISSLLASLGLIQQEIANQKVEFSSVTRRLEEERKQHEEQLLKEKEERE
RLEKERLEKQRTEYEKQAEEARLKHEEELANLKQTHDEALKEAQLQREAAAKQLEEEQQR
-------------------------REQVERE--RTRLQGEKAIEAQQRGNPEDKRLEAE
HEEKLRRQAEAASAVENALKSSNK----------------KTKAAVP-------------
------------------------PANTTNS-SLYDYETVEEVITVD-------------
------
>SAKL0F02772g
------------------------MSIFKKKQQV-DPFAHLLQ--PEQPQEQP-------
--------NFLRKVVT--------------N----------KKKEEEEKDYSS-------
------PFRSQ-----------------QELIAAKNVKAKKFPTVSATS--GTAS-----
AADLGYKVI-D---SAKRRAKDISV----PRYLKNTDEKQRKKLDKLEFKENHLQYLKDS
QKIVDVRKKNKEEQPAAVAAA----------TADAVEKPEGIEEVEDVGGSVGKEEITSK
EHSVPELT-------------------------------------SVEDTVEPTQELVEE
PVGELVQEPVE--------------------------------------------DLVQE
PVQENVDDLASFTPSNSSVGVFDSPTDEIVEAVPILEGSDHEGGTRETTADDELQDDEPP
IPKPDVIETTETHKTTTGKEDQAEQELEE---------------------GQADGLAHGL
AQPIDPNKAPR-VPFKA----------------KTGVF-ALWTRSDK-------------
------QDQPLATPQDPEYIVRTDK-G----YMSKAIYDKLEYDEQVHQNELATFNKEQA
DKYDATEKEYNDKLTLLQSQIDELQATMEQLRLDTKEKIKVSESELSKKMLDLNATHISS
KNVIFKETENIKTQKIAERDEITAKHEEVK-AEIEELNVLKKQVDAEFNEYQAKLDDLTA
QLDSKVEKIQELNDKQMEITGLIAELNQKKLEIETETRDAEELHKESTGILESIK-NKEY
LP--KINAIDSQVATLLGSLTLIKQENANQKTEFAAITKRLEEERKAHEEKLRREEEERK
RLEEERLQKQREELEAKAEDARLKHEEELRQIKEEHEKALNDANV-------QLAKEKEE
-------------------------REVVERE--KTRLAGEKAIQEQERAQEADLALKQE
LMEKRRKQAEAVDAAEQARKIST-----------------QKKSVLSNPS----------
------------------------QNLTRES-SLYDYETVEEIITVDE------------
------
>KLTH0F14828g
--------------------------MFKKRQ---DPLEHLFQ--QSEPQTGDAD-----
-------KGFLHKVVS---------------------------KEQEQSAYNS-------
------PFRTS-----------------QSLAAAQKRKMQKFPTVSASV--SAHS-----
SSDMGYKVI-D---AARRRAKDIAV----PRYLQGNDERQRRRLDKLERKEDALKYKKDS
QRIVDVRGGQDRAAG----------------AAEDEGDVATDAEVEAAADAETEAEADAE
AHTQTDAG-----------------------ADAGVAASTAESVAASTKDAEAVPATIDE
TPVSDTQDYVT-----------------------PGAEAPDAESGIAEPETSAAIAESEV
PAAIAVTETPVDGAAAEPEVPVAAAAESEV---PAALPSSETAGAEPTETATVNSKEVAV
GTAPDAASSVQKVPAGVDLVGEPAVAEAAGEQPAT---------------EGKINADGVP
EKPKDIKETPR-VPFAT------------------GIF-ALWTRSDK-------------
------RGQPVASPNDPEFIVKFDK-G----YMSKALYDTLEYEEAIHKREMDDYTKEHD
AKYEAKANEYEDRLTSLKSQIAELEATMETLQKDTTEKIEISEAKLSAQMIDLNAEHSSS
KNVIFKETENMKAAKVEEKEGVEAKQEDVK-TELEELEKLRAEIDAENREHQGRVDELTA
ELDAKLAAIQELNTQQAELQASIDDLQQQKDALISEANAADEQHGSNVAVLESIE-NKEY
LP--KLNAIDTKISELLTSLTVVKQETANHKTEFAAVSKRLEEEDEERKEKLRQEEENRK
RLEAERLQKQREEHDQQILLLQQEHERQLAEASQKAAEHEQALLKEREQ-----------
-------------------------RELVERE--RVKLQGEKAIREQEEAKAADKALEEE
IKQRNHSRALALDGAEAAVQKSQKEITEQKKTPLLPASEQKETPLLPAPVQ---------
----------KETPLLPAPESAQPKALTNDNSSLYEYFTEKEIRTVNSSTSAFTKA----
------
>Kwal_55.21229
--------------------------MFKKKH---DPFEHLFQ--QDQPKKETSK-----
--------GFLRKVVT---------------------------KEQEDATYSS-------
------PFRTS-----------------QSQVEAQKRKVQRFPTVSASS--GGNS-----
SAEMGFKVI-D---AARKRAKDIAV----PRYLQGNDERQRRRLDKLERKEDSLQYKKDS
QKIVKVKGEVGKSSTVETEPEAVE-------STKPVETEPEEAETTKPVETDEPVKPIET
GEPVKPIE-----------------------------------------TTEPVETDEPV
KPIETTEPVET-----------------------------------------TEPIETTE
PVEATEPVAAAEPLTTTEPSETTEPIETTEPVQVTEPVESTEASKPIETTEASQPIESTE
ASQPTPTTKASPDDEGIVGESLVADASAAAET------------------PAAAETSATL
QKPKNIKDTPR-VPFAT------------------GIF-ALWTRSDK-------------
------RGQPVASPDDPEFIVKFDK-G----YMSKALYDTLEYEEAVHKQEMDQYTKENT
DKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDTTDKINISAAELSARMIESNAKHSNT
KNVIFKETENSKAAKIDEKAAVVAKQDEVK-AENEELEAQRAEADATNQELLSRIDELTT
QLDSKQSAIQELNDQQAEIQASIDALEQQKDTLVADATAADELHNSNIAILEGIS-NKDY
LP--KINALDSQISQLLSSLALVKQETANQHTEFAAVSKRLEEENEERKEKLRLEEENRK
RLEAERFQKQRDEHDQHVLTLQQEHERQLAEASQKAADTELLLQQEREK-----------
-------------------------RELVERE--RVRLQGEKAIQEQEQAKLADKALEDE
VKERNHNRAQAIDAAEAARARNAKSISN------------NNAPALSTPKE---------
----------DEKLNI--------KDATTDN-SLYEYFTEKEVRYVNSNSSLLPQN----
------
>CAGL0I10516g
-------------------------MSFKSD----DPIGRLLQEGSQEKKKSILTRSVED
TGFVSPFRRGLTSASAAASVSASASASRHRR----------FSNDSSDSDSDSRDAHNAA
SGGRSDSSRSDSSSDSDNEQKIAVNPFTNKPAYNKNAKQMKFPTVSATSALANQD-----
PKELGFKTL-D---KSTKRAKDIKF----PVYLTENEFRQQTILKELELKEGKLQYLKDS
QKIIDLTIRQPDSDE----------------EQQDEQDEQDDTEVEDNVDAENQQAHTKD
NDTITDKE----------------------------------------DMASQDAPEKEM
SPREDSLPHPD-------------------------------------------------
---AAETKIMQHKDIDAPKLQERKPTPDVDVAAEQAEEVAETDGDVDAKEVDAEAGAEAD
AEAKAADAVMDSEAEPESQEKMAPSVKDTSSALA----------------SEDLESYMTV
ETPQPYDKVPR-IPYTE---------QPESG----KKFSSFFKRNDN--AGHPVITDVPV
IPDQSQLDFPIATPENPELIAKTEEYG----YMSKPIYDKVVYDETNHRRWLKGFKKSEK
AKYDDKMEEYNNELEELQKEIDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQ
KNKIFKETENIKNQKIQQKKEILDKHAVVQ-DEITQLNDRKKEVREEFDKWTTNMTTLGQ
QLDAKIMKVTQITMKQDETQKEIEKLETQKKEYQAQIDAAKKEHEEGQKVVESYE-NKEY
LP--KIHTIDNQISELLNELAIIKQENANEQTELSKITKELEEERRAHEEKLKLEAEERE
RQEKNLLEKQRLELEEKAEQQKREHEEQVRKMKEQYENE---------------------
-------------------------LNNVKKQ--KESLETEKLVEEHNRNEN----IKKE
VLDKQRKQAEAQHAAQTKSIATNA------------------------------------
------------------------ANDMQDN-SLYEFKTEEEIMYV--------------
------
>Suva_7.418
-------------------------MLFNTSRQEDDPFTQLINQSSAQNQQVQQQ-----
----EKPYQFLQKVVS--------------------------NEPKGKEDWVS-------
------PFRQDALSGNQ-----------NNRLYVHDAKNRKFPTVSATSPYSKQQ-----
PQDLGYKNI-P---KDVKRAKDIKF----PTYLTKNEERQYQLLTELELKEKHLKYLKKC
QKITDLTGDANDDTTSTTS------------SSSSLSSSDDEDTASATAPAENETATTAT
TTATSTTS----------------------------------AAGDSADEATSIEEEQKE
NAGETTPTVET---------------------------TADNEKEIQEPETFKDEQNLAE
PAVAEITPVTARSDIPESAVAAASDDVPEVAVANTSDNVPEVTVAAASDEVPEEAVAPIE
EQTEKTSVVKTDTVTKEGKGEVADVEEETEQSSADEHGEETSTP------ETSEAESDGD
ITPIDPSKAPK-VPFQE-------RPQKERT----GFF-ALWKSPTS---------SSAK
KGAATAPLNPVATPENPELIVKTKEHG----YLSKAVYDKINYDEKIHQAWLVDLRAREK
AKYDAKNTEYKEKLQDLQNQIDEIENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNK
KLMIFKDTENMKKQKLEEKNEVLNKQTNVK-SEIDELNSEKSNVQKEFNDWTTNLSSLSQ
QLDAQIFKINQINLKQSKAQNEIDNLEKQKKDLITQTEENKKLHEKNVEVLESVE-NKEY
LP--QINDIDTQISTLLNQMTIIRQENANERTHLSAITKKLEDERRAHEEQLKLEAEERK
RKEENLLEKQRQELEEQAHQAELEHEEQITQVKKTYNDQLTELQD-------KLAAEEEE
-------------------------LEAVKRE--RTKLQGEKAIEEQTRQKNADEILKQT
ILDKQHKQATGLHAAENRVNTPSSNLQESK------------------------------
------------------------RAVPKND-SLYEYHTEEDVMYA--------------
------
>Skud_7.441
-------------------------MLFNTNRQDEDPFTQLINQSSANAQNQREQ-----
--QEEKPYQFLQKVVS--------------------------NEPKGKEEWVS-------
------PFRQDALSRNQ-----------NNRLYVADAKNKKFPTVSATSAYSKQQ-----
PKDLGYKNI-P---KNAKRAKDIRF----PTYLTKNEERQYQLLTELELKEKHLKYLKEC
QKITDLTSDGNDDAATSADSSL---------SSSDKEDSTTSKGNEIAGEAAAADMTKIT
TTTAPTSS----------------------------------AVGDSGDEATSIEEEQDD
KASETTSVEKA---------------------------------------AAGNGEGAQE
PVALKNEGSVAEPTAVTTQVDVPEPA-------VTSQSNVPESAVLPTEESKSETSVVKE
VNPTEEGQTEEVHDEEDEKSEQSSVEEHGEETSTP---------------ETSEAESVED
KAPIDPSKAPK-VPFKE-------RPKKERT----GIF-ALWKSPTS---------SSAQ
KGGVTAPSNPVATPENPELIVKTKEHG----YLSKAVYDKINYDEKVHQAWLADLKAKEK
AKYDATSTGYSERLQDLQNQIDEIENSMKAMRKETSEKIEVSKNRLVKQIIDVNTAHNNK
KLMIFKDTENMKNQKLQEKDEVLGKQTAVK-SEIDELNSAKTNVQKEFNDWTTNLSNLSQ
QLDAQIFKINQINLKQSKVQNEIDALQKKKEDLIAQTEENKKLHERNVQTLESVE-NKEY
LP--QINDIDNQVSTLLNKMTIIRQENANEKTELSAITKRLEDERRAHEEQLKLEAEERK
RKEENLLEKQRQELEEQAHQAQLDHEQQITQVKQTYNDQLTELQD-------KLAAEEKE
-------------------------LEAVKRE--RTRLQGEKAIEEQTRQKSSDEALKQE
ILGKQHKQAEGLHAAEKHNIPNSHSPKNE-------------------------------
------------------------ILVPKDD-SLYEYHTEEDVMYA--------------
------
>Smik_6.226
-------------------------MLFNINRQNDDPFTQLIN--QSSENGQSKQ---AQ
Q--KENPYQFLQKVVS--------------------------NEPKGKEEWIS-------
------PFRQDALASKQN----------NNRLYVEDAKNRKFPTVSATSAYSKQQ-----
PKDLGYKNI-P---KNAKRAKDIRF----PTYLTQNEERQYQLLTELELKEKHLQYLKKC
QKITDLTKDEKNDNGTATSSSMST-------SSSSSSSSSDDEGIASTTTTENNEAIANT
STTMTTST------------------------------STTSINEHGSDEATSIEEKQGD
KASESTSIEES----------TSKNDNNVREAASLNDEGNVAESSISKTTADSTQMNVPE
PAATSQRDTSAQVVTSSNDASE-----------PHTKSESGISKSDIIPTEELKEETVVA
KKISSAVKSTEEEEGEGEETEQSSVEEPGEETSTP---------------GTSESESEED
KVPIDPSKAPK-VPFQE-------RPRKGKT----GIF-ALWKSSTS---------SSAQ
KSNTAAPSNPVATPEKPELIVKTKEHG----YLSKAVYDKINYDEKVHQAWLTDLRAREK
AKYDAKNKEYEEKLQDLQNQIDEVEDSMKAMRKETSEKIEVSKNRLVKQIIDVNAAHNNK
KLMIFKDTENMKNQKLEEKNVVLNKQTNVK-SQIDELNSEKTNVQKDFNDWTTNLSNLSQ
QLDAQIFKINQINLKQSKVQDEIDSLEQKKNALVTQTQENEKLHEKNVQVLESVE-NREY
LP--QINDIDNQISTLLNEMTIIKQENANEKTQLSAITKRLEDERRAHEEQLKLEAEERK
RKEENLLEKQRQELEEQARQAQLDHEEQITQVKKTYNDQLTELQD-------KLAAEEKE
-------------------------LETVKRE--KTRLQGEKAIEEQTRQRNADEALKQE
ILSKQHKQAEGLHAAERYKIPNDHPQKNK-------------------------------
------------------------NVVPKDD-SLYEYHTEEDVMYA--------------
------
>YGR130C
-------------------------MLFNINRQEDDPFTQLIN--QSSANTQNQQ---AH
Q--QESPYQFLQKVVS--------------------------NEPKGKEEWVS-------
------PFRQDALANRQ-----------NNRAYGEDAKNRKFPTVSATSAYSKQQ-----
PKDLGYKNI-P---KNAKRAKDIRF----PTYLTQNEERQYQLLTELELKEKHLKYLKKC
QKITDLTKDEKDDTDTTTSSSTSTSSSSSSSSSSSSSSSSDEGDVTSTTTSEATEATADT
ATTTTTTT-----------------------STSTTSTSTTNAVENSADEATSVEEEHED
KVSESTSIGKG--------------------------------------------TADSA
QINVAEPISSENGVLEPR---------------TTDQSGGSKSGVVPTDEQKEEKSDVKK
VNPPSGEEKKEVEAEGDAEEETEQSSAEESAERTSTP-------------ETSEPESEED
ESPIDPSKAPK-VPFQE-------PSRKERT----GIF-ALWKSPTS---------SSTQ
KSKTAAPSNPVATPENPELIVKTKEHG----YLSKAVYDKINYDEKIHQAWLADLRAKEK
DKYDAKNKEYKEKLQDLQNQIDEIENSMKAMREETSEKIEVSKNRLVKKIIDVNAEHNNK
KLMILKDTENMKNQKLQEKNEVLDKQTNVK-SEIDDLNNEKTNVQKEFNDWTTNLSNLSQ
QLDAQIFKINQINLKQGKVQNEIDNLEKKKEDLVTQTEENKKLHEKNVQVLESVE-NKEY
LP--QINDIDNQISSLLNEVTIIKQENANEKTQLSAITKRLEDERRAHEEQLKLEAEERK
RKEENLLEKQRQELEEQAHQAQLDHEQQITQVKQTYNDQLTELQD-------KLATEEKE
-------------------------LEAVKRE--RTRLQAEKAIEEQTRQKNADEALKQE
ILSRQHKQAEGIHAAENHKIPNDRSQKNT-------------------------------
------------------------SVLPKDD-SLYEYHTEEDVMYA--------------
------
>NDAI0G00940
----------------------MSLKLGSKKN---DPFEHLLN--PQPKTTGSSD---SS
R--PRSSSLFLQRVISSTSS-IQKTPTTSSS----------SKKKVSTEEYLS-------
------PFRSNLVT--------------NNKAYIQNEKTKRFPTVSATSNYTNRT-----
SKEMGFKKI-P---KDKNFAKDIFF----PSYLTQNEQRQQIELTKLVKLEKDLQYKKDS
QNIIDLT------------------------KQPSQSQSPSPLD----------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------------------------DSANAEKPPL
EKPIDPKLTPM-VSFQL------------------STP-PVNNKNKK---------TQVV
PEEEEKERNPKATPNSKEEIVKTKKFG----ILSKSIYDQLQYDQQQHEQYLASYKAEMQ
EKYDVKMQEYENELKSLDEKIVASNELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDD
KMKIFSETKLIKREKIDEKINVEELDDQVV-GEIDQLNKEKEKVYDEFNEWTFNMTNIAE
QLDAKLFKIKQINITQMNLQNKIDGLNNEKLGLTKEIEANKFTHANNVETIENVD-NKQY
LP--KLNNIDSQINDLLNQLTLIKQENANEKIQLSELTQKLEKERMDHEEKLKLDAEERK
RQEENLLGKQREELEQKANDLQLNHETEMTNLKTSYEQQLADFKS-------KLMEQQDK
-------------------------VDDLKLQ--KSRLEGSKAIEDQDRQKQSDNVLKNE
ILSKQHQQAEAYNAVQLAQKKK------------------NASPVAEDLMK---------
----------ESHIPA--------LSKAKDD-SLFEYETEEEIMYV--------------
------
>NCAS0E00810
--------------------MPSSILSFKRRD---DPFDHLFE--EAEAAEAAKH---NT
SMAPRTTSSFLQRVVSTTSSTTQKQPKKKIA----------ASEAKAMSDYAS-------
------PFRAE-----------------YSNVNVQNEKTRRFPTVSATSNYTLKN-----
PKQKGFTTI-K---KGQNFAKDIYF----PNYLTENEQRQQAELLILEKKEKDLKYLQDS
QNIIDLTKKQEPKK-----------------APTPVASTTEEIDEATFPHSNISEEINPD
YEDEEQSS----------------------------------------------------
------------------------------------------------------------
---------------------------------------------------AQNNEQLVL
VQS-----------------------------------------------EEEIHTPNVV
EPPIDPALAPM-VPFSL----------------------ATPNQKSK-----------KE
TEAPEKPSNPVASPTNQEEIVKTAQFG----YLSKAVYDKIQYDEQQHKKWLADYETKQN
EKYEAKMQEYKKSLQDMDNQMSELNDLIEKCELDTKEKIDVMHGQLVKKVFDKKGVQIND
KMKIFNETKQIKLEKLSEKENVLNDNTEVK-QTIDELTNEKNKVRSEYDNWTTNMTNIGS
ELDAKLFKISQINVTQMNLQNKIDALTSQKNNLQDEIAKNKNIHDSNVKLVESVD-NKEY
LP--KLNDIDNEINGLLNQMTIVKQENANEKVQLAEITKKLEDERRAHEEQLQLEAEERK
RQEENLLGKQRDELEAKANTMQVNHQQEIDALKNDYETKLEEFKN-------QLKQEQDQ
-------------------------LDQVKRQ--KTRLEGEKALDEQKRQKDADDVLKNE
IFEKQHKQAEAFSAAQLKGRKH------------------PLAALAREITG---------
----------EAK------------PSSKDN-SLYDYETEEDVMYV--------------
------
>KNAG0B00810
----------------------MAIAGYDRLVQEHEDAVSLQSSGASSRGSRVSR-----
--------GSFRRAIG----------------------------TAATEEYVS-------
------PFRGGQLTK-------------ASKKQLQLQRTKKFPTVSATSLYNSYN-----
TRELGFSKV-T---DDQRRARDIVF----PEYLLENEDRQRLILKDLEKREQTLLHLQRC
QSVLDRT------------------------CKPAKEEKRKELKAIEPVKRDTTNRFAID
YDFVPPVD--------------------------------------------PTQEEKDE
IDVSDPIVREY-------------------------------------------------
-----------------------------------------------IRDARGIPRAEAN
GGDASGDASGYDYDRDVLNIEQNQLVDAQ---------------------QMALQNEIEW
RKPVDPATQPK-LYVDL------------------DSLQLIDPGSTA------VGVSTKQ
RLMDTPVTNPQATEDTPELLLKLPKYG----HVSAAVFNKVLYDDKVHKAEMADYQREQE
SKFAKKLQEYEQKLAQVDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDS
KVKVLHEAQLVKLQKLQDLKFISQKKTLMQ-HEVNQLTLEKSHAEKDYHLWTTNLTNITE
RLDAQLFKLSQFNHKQDKITRQIRDLTQRKTELEAEIDANQFSKGNADRNLADLE-TGQH
LKSHELVKVTDSIQGKLDSLAVVKQEISGERLKLIGITNEMERARAERERIWNEKLDSNT
KFYEDKLGEKDADLDERLKQLDVEHTANLVQVREIYEAKLQDSAEKAEEAEQQLKLAAEE
-------------------------KAQIEKSLLDQEQQAKKELEDMQKERDFAERRAKD
ESERADQHLEQKVAIEMERKEWAKKIADAEERANIATKARVNAQHERSNAESELTKARN-
------------------------KPIFENN-SLYSFATEEVTTFK--------------
------
>KAFR0C01960
--------------------------MFKTRSLADEAFDKLLSETTSVKTTDTAK-----
------KHQFLSKVNT-------------NK----------SKENDDENKYNS-------
------PFRNNAPSR-------------EQKKQLQDLKTAKFPLVSATSTYNT-D-----
TKDV-YKDL-D---PKKNFARDIKF----PSRLIDNENRQNQILLDLKIKQDALDRLKDS
LQVIDVEDL----------------------PRDDKEKGEEEKDSDPVPEQPSNNENITD
KDALQDAY----------------------------------------------------
------------------------------------------------------------
----------------------------------------------------DLNSKAAT
KTDPDIVSHNYSVLNKNNLIDAK---------------------------DMSIENKLFY
LKPIHRKDYPK-VQSTT-------------------------------------------
-----ESKFPVASPENKETVVKLTSGK----KISKYVYDKIEHDTKVNDQYIVKYQNDQL
NKLNKLKSEYNEKIKSIQLEKFKTLNEIENLNLESFNNFEVIQNKLVKNLMDSTATFSDN
KVKILRKTGQLKLQKLNELKFLNQKRNLIR-REANMINVEKDSYKTNFNYINCSLNEILQ
ELDAKLFKLSQDNIRNENLEHEINKLQSKKQTLLDEIDSIEYKKLHPDDDSKQL------
----ELNEMDEQINSKLSNLNLIKQEIINEKLKISKLTNDLNLQLIENKN----------
--ENLRIMDENTKLNDKIHNMQELHKNELKNLTERHENS---------------------
------------------------------------------------------------
------------------------------------------------------------
--------------------------------DTYSYVTEEQIQFQ--------------
------