MUSCLE (3.8) multiple sequence alignment

CAGL0I10560g       -MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADS-FTPDSNSVLLGISGSSISKYVITP
TBLA0C04460        -MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLGISGSGISQYIINP
KLLA0E04665g       -MASISQPFRLSALPKIPSLNNYANQTDYLQVVDN-LSPSANKVNIGISGSSISQYLINP
AFR307C            -MAYIAQPFRLANLPKISSLNNYAQQTSYLQVADV-LEPTSNTVTVGVSGSSISQYVINP
SAKL0F02838g       -MASISQPFRLTALPKIASLNNFSTQTDYLQVANT-LTPSANKINIGVSGSSISQYIINP
KLTH0F14762g       -MPSISQPFRLTALPKIASLNNYATQGNYLQVADT-LTPTTNNINVGVSGSAVSQYIINP
Kwal_55.21222      ------------------------------------------------------------
ZYRO0D10054g       -MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVSSD-ISPNSNKITIGISESAISQYILNP
TDEL0D05570        -MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADD-IEPTSNRITIGISESAISQYVLNP
YGR128C            -MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINP
Smik_6.224         -MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINP
Skud_7.439         -MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINP
Suva_7.416         -MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLGISGSSISQYIINP
NDAI0G00960        -MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINP
NCAS0E00830        -MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNP
Kpol_480.16        -MPSFSQPFRLAVLPKILSLSNVETQISSLQIADD-FSLESNKITIGISGSTISQYIINP
TPHA0D04230        -MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADD-FTLDSNKITIGVSGCAVSQYVINP
KNAG0B00830        MSASISQPFTIANVPRQASQTK-------VLISQHSLTSNANTLDVAVSKYSISQYIINP
KAFR0C01940        -MPSISQPFAITTVPKQSSTSP-------IIVSSHSLTANSNSLDVAISKYAVSKFVINP
                                                                               

CAGL0I10560g       TPRLIFNVPIPSTHLVSACNMGTYSETSTVSSDPQATADETTDTAPTSTNTVE-------
TBLA0C04460        TPKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENT
KLLA0E04665g       TPKLVFNLPIPSTNIVTACDVVE-------------------------------------
AFR307C            TPKLVYNIPIPSTNVVTGCDVLA-------------------------------------
SAKL0F02838g       TPKLVHNLSIPSTSIVTACDVSEIQQNEG-------------------------------
KLTH0F14762g       TPKLVYNQPISSTNVVSACAVAEITTTS--------------------------------
Kwal_55.21222      ------------------------------------------------------------
ZYRO0D10054g       TPKLLSNISIPSTNVVSACDVAT-------------------------------------
TDEL0D05570        TPKLVLSIPIPSTNIVTACDVA--------------------------------------
YGR128C            TPKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQ-----------
Smik_6.224         TPKLIFDYPIPSTNIITACNAGEAQVNIE--------DKDNNEKVINSQ-----------
Skud_7.439         TPKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQ-----------
Suva_7.416         TPKLTFDYPIPSTNIITACNAVQGQVEIENDTKNSDNDKTDHE-VTNFQ-----------
NDAI0G00960        TPKLIFNYPIPSTNIVTACDVLENDN----------------------------------
NCAS0E00830        TPKLIFNFPIPSTNIVTACNVFEQ------------------------------------
Kpol_480.16        TPSLVFNVPIPSTNNVTACNIGHFVSDT--------------------------------
TPHA0D04230        TPNVSQTVPIPSTNNVTACNVAQYKDAD--------------------------------
KNAG0B00830        TPKLVNSKAIPSNLTVTAFDNG--------------------------------------
KAFR0C01940        TPKLINSIPIPSNEVVTAFHDT--------------------------------------
                                                                               

CAGL0I10560g       --ETKHYEIWCYALSANNKTHTLNCLIREVD-----------------NNNTSITENNPQ
TBLA0C04460        DVTKRSVELWAYGLVANK-SNTLNISVKTTG---------------LDEFSTTPGEIIRK
KLLA0E04665g       --DAANTEVWCYGLEARK-VSHLHLATKPMI---------------QDAVSSSNAEITSQ
AFR307C            --MSDGAELWSYALTANGKVHTLHAVLRKAGA--------------APQETGLDASEDEH
SAKL0F02838g       --DTETQEVWCYALVANK-SFTLNTIIKPLT---------------ADAPSVNSTQTFEN
KLTH0F14762g       --EKDSQEVICYGIQSNR-VYSLCATIKPVS---------------STASDSSFGETYAA
Kwal_55.21222      ------------------------------------------------------------
ZYRO0D10054g       --LADDKEIWCYCVKSGK-SHFLNASVKPVDA--------------DTVLDTDGGDKTED
TDEL0D05570        --RSDEQEIWCYALQAGK-VCTLNVASKVSH-------------------AENGVNSDDV
YGR128C            --KKRNVEIWAFGLMVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQ
Smik_6.224         --TKRNIEIWSFGLMVNKGNYTLNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQ
Skud_7.439         --TKRNIEIWSFGSMVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQ
Suva_7.416         --SKRDVEIWSFGLMVNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQ
NDAI0G00960        --DNTNNEVWCFGLVANK-TYTLTLITKDKQKSSATMEDD------EDVVDVIDTTIKDE
NCAS0E00830        --KGSSEETWCFATMANK-TSTLNLINKNQYQTNEEE---------SGDSAPSDSSVTSE
Kpol_480.16        --DGSKLECWAYGLSYNK-NHTLNISIKTSD---------------DDKYATSGGEVVET
TPHA0D04230        --TEELFEIWVYNLAVNK-KNTLHVAIKTVD---------------PDKFSTTQSDALET
KNAG0B00830        ----------VYATQSNNKSFCLYL--------------------------------DES
KAFR0C01940        ----------VFATATVNQKYTLHLNGK--------------------------------
                                                                               

CAGL0I10560g       FNAKFKEQIINIEVDTKHK---VIVILFETGLVQFYDLQLKLLNSINTPYRDIKIVKTFE
TBLA0C04460        KTIKVDSKVVNIKIFKEFK---TIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFT
KLLA0E04665g       FKYKLKSEVVSIKIYSKAE---KVLVILRNGLIQTFDYELKLSNTIDISYDDIRFVQFFQ
AFR307C            FKQTLKGRVVRVRILSACK---RIMVVLDCGLIQTYDYQLQLLHSLDISYTNVGLVEYFT
SAKL0F02838g       YKVSIKHKVASVKIFPSRK---TIIAVLQNGLVQTFDFQLKLLHSADISYGNISLVKYFT
KLTH0F14762g       HKVSVSDQIVNLKVFPDTK---SIVAVLRSGLIQFFDFELKLQHSLDSSYKNVSYVQHFT
Kwal_55.21222      ------------------------------------------------------------
ZYRO0D10054g       FKIKMDSKVVGIKIIPDYK---AIVVVLESGLIQYYDFQLQKLSSLDISYQNVKVVNYFS
TDEL0D05570        LKVKVDDQAVGVHVNGKDK---TIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVSVTKFFT
YGR128C            YKIKAKAKVMSIKIDTKNS---LVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFT
Smik_6.224         YKIKAKAKVMSIKIDTKNN---LIIAILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFT
Skud_7.439         HKIKTKAKVMNIKIDAKNS---LIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFT
Suva_7.416         YKIKTKDKVMNIKIDAKNS---LVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFT
NDAI0G00960        FNVKLDSKIVDIKIIKKKADDISIMIVLENGLIQFFNSSLKLLNTVKINYKNVKFVEHFK
NCAS0E00830        FKIKADDHVVDIKILNKKK----IIVVLKNGKIQTYDFELKLLNSINMAYNNVRFVEHFH
Kpol_480.16        YSQKCDDKIEHIKINEKEK---VIVVVLKNGLIQFYDFTLKLLKSVNVMYSDISFVEHFE
TPHA0D04230        YTVKCDASVVGIKINKEDK---TIVVTLGNGFIQIFDFKLKLLNSVNTSYDNIYFSEHFV
KNAG0B00830        HQIPLKSAVVNCLSEKIHDESVVTTAILQDGTVQKYKGGEQVFAK-HLPLKDIKQVEFID
KAFR0C01940        -KVPIQSKIM--KLFSDES---QTITILENGTIEKYDSNL-IKSTYKTPHKDLVNVEFIE
                                                                               

CAGL0I10560g       -ENGLEYMLLISDLKDQK--VALQLYEVST----EEKKVKELTSSIIENFNLQDSLLCYQ
TBLA0C04460        -ESKQNFLLILSNIDEEKSSVCFKLYQLRLDS--DSNQVSELSFSILQDFDLSKSKLSYQ
KLLA0E04665g       DGQGNDFFFVLCQLSDEK--ICYKLFQVRS----ESVSCIELNSIILENYTLENAKLCFE
AFR307C            DSAGKDYMFVLCDIQNKK--TCYKLFQLNHSA--ENLPITELNSVILEDFALAESKMVYQ
SAKL0F02838g       NEVLQDFMIVLTDLNDDK--VCYKLFEIIHHD--SNVPLKELNSVILEGFSLQNSKTFYQ
KLTH0F14762g       SESGQRYTFLLSDIDGHK--VSFKLFEIGQSD--SATPATELSSVILENMCLKDSQIFYQ
Kwal_55.21222      ------------------------------------------------------------
ZYRO0D10054g       -ENGQNFMFVLSGFENNK--VCFKLFELLYHDGKRHTPIKELSTTILENFNLDQSKLCYQ
TDEL0D05570        -EGANDFLFILCSLPEDK--VCFKLFELSLPNY-NQVPIKELSSIILEDFSLATSKICYQ
YGR128C            -ENGTEYVFVLCPLQDDK--VCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQ
Smik_6.224         -ENGIEFIFVLCPLQDDK--VCYKLLELTDYENRENSPIKELSSTIIEGFSFDDSKLCYQ
Skud_7.439         -ENGTDFVFVLCPLEDDK--VCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQ
Suva_7.416         -ENGTEFVFVLCPLEDDK--VCYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQ
NDAI0G00960        -EDNKDFMFTICDLGDNNK-VCIKLFQI------NNDSAIELNSIIMENFNGQNAKFCYQ
NCAS0E00830        -EDGKDFMFVLCDLENDK--VCLKLFQINENIETINDSAIELTSTILENFPLENAKFCYQ
Kpol_480.16        -EDGKQFAIILSNIEGKK--ISFKLYELFTN---DKTSINELSSTILEDADLGESQICYQ
TPHA0D04230        -ENKKSFAIILSTIEGNK--LSYKLYELFGQ---DKTSIKELSSTILEDIQCKDSKISYQ
KNAG0B00830        ----GQYALIVAA-------QSTALYELE-----NLTELRVSTTLHFEQFK----QIRQH
KAFR0C01940        ----SKYALLISQ-------NSISLYDINTMI--ELRNVANVQDIVDSDFKSLDGKL-YQ
                                                                               

CAGL0I10560g       FGRIYR--L-FKDEIEVYSIPSLQLNSKVKIPFLSEIEDKNCLISLKPIATNRVLLTVKN
TBLA0C04460        FGKLYR--L-TGSELFVYSLPQCQLLQNISLAEI--FPNTIDVSSIKPVANNRLVLAINN
KLLA0E04665g       FGKLYV--LKNSNELSIYQLPHLQLQTSIQLPFI----SKDAVVSIKPVSSNRVLLTADN
AFR307C            FGKLYR--L-VDSKMYVYSLPHFQLSHCVPLPFV----RKDDQVSLQAISTNRLLLTCCN
SAKL0F02838g       FGKIYT--L-SNGKISIYSLPHFQLSNTINLPFV----THENVVSFKPISTNRALLTVDN
KLTH0F14762g       FGQVYR--L-HGNAVSIYNLPHFQHSRTIELPFL----APESIISFKPISTNRALLTSDN
Kwal_55.21222      -------------------------------------------MSFGPISINRALLTCDN
ZYRO0D10054g       SGKLYQ--L-EGSTIKTYALPQCHLVQTTHLPMI--LDPNSQKVSLAPVSTNRILLTVNN
TDEL0D05570        SGRLYR--L-IGHEVLVYALPQCQLVQAVTLPMV----QGADVISMKPISSNRILVTADN
YGR128C            FGKLYK--L-NQGKIYIYSLPHCQLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNN
Smik_6.224         FGKLYK--L-NKGKIYVYSLPHCQLQQVIELPLINNSDFEHDLISFQPVSVNRVLLTVNN
Skud_7.439         FGKLYK--L-NQGKIYVYSLPHCQLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNN
Suva_7.416         FGKLYK--L-NQGKIHVYSLPHCQLQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNN
NDAI0G00960        FGKFYK--L-TNNNLMVYSLPQFQLEHTTTIPMI---KTDDQIVSMKPISTNRILLTINN
NCAS0E00830        FGKFYK--L-TDDKILVYSLPQFQFQYSITLPMITDLKEGERVVSFKPISPNRILLTVNN
Kpol_480.16        FGKIYR--L-FEDRLYIYNLPQCQLQQTIELPFI--QKKDSDVLSFSPIANNRILLTVNN
TPHA0D04230        FGKLYR--L-YKNQMFVYSLPQCQLVDTITLPQI--DLKKSQAISFKPVSNNRILLTVDN
KNAG0B00830        LGKIYQFDL-ATNDFKIFELTTLNEIGVVNIPFL--SASKGAPLTFTVVGDSRVCLALAN
KAFR0C01940        FNQ-------KLSKFDIWEISSMTIVNIITIPFIN--DVEKDVVSFTVVDDNCVVMAVNS
                                                               ::  :  .   ::  .

CAGL0I10560g       KIYLLDLLHKSILSEREVSHMKTFQILKTAM--NRDGSE--SK----LTLALGISTKNGQ
TBLA0C04460        VVYLIDTLHRSILAEREFTHVKTFQLLQSATIG--DSNI--TQ----RTIAIGVSTKSGP
KLLA0E04665g       TIYLVDLLYNAILFQKDLQNIKAIQLLSTAVVQ-ENSED--NR----KTIALDVTTKNGA
AFR307C            KIFLLDLLHNAILYERELSNIKFFQLLRAAVIPGTTPGE--SN----RTFAIGVSTKQGS
SAKL0F02838g       RIYLLDLLHNAILSQRELTHVKTFQLLTTAIIPGNTA-E--NN----KTIAIGVSTKSDN
KLTH0F14762g       KIFLLDLLHNAILSQREMGHVKIFQLLETAVIPGNST-L--NN----KTIALGVSIKHGS
Kwal_55.21222      KVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSS-S--NN----STIAIGVATKPGN
ZYRO0D10054g       QVYLLDLVHSSVLSERTLTHAKTFQLLRSAPLNVSSSLK--GSEFATRTLAIGVTTKNGN
TDEL0D05570        KIYLLNLTHNSILFQRELTHLKSFQLLKSAVIDSRVSSSLPNQ----KTFVIGVGTKHGK
YGR128C            VIYLLDLLHCSTLSQRELTHVKTFQLLKSAVINSEK-SH--NS----KTIAIGISTKNGP
Smik_6.224         IVYLLDLLHCSTLGQRELSHVKTFQLLNTAVINSEK-SH--SS----KTIAIGISTKNGA
Skud_7.439         IIYLLDLLHCSILNHRELTHVKTFQLLKSALIDSEK-SH--NS----KTIAIGISTKNGP
Suva_7.416         TIYLLDLLHCSILNQRELTHVRTFQLLRSAVIDSEK-SQ--NS----KTIAIGISTKNGP
NDAI0G00960        KIYLLDLIHNSILSERELTHLKSLQLLRSAVIGKGE--N--NN----KTITIGVSTKFGV
NCAS0E00830        KIYLLDLIHNSILSERELTHLKTFQLLKTAVVDTNI--N--QN----RTLAIGVSTKFGS
Kpol_480.16        KIYLLDLVHNSILAERDLSHVKVYQLLKSIVVPSKGENK--NS----KTIAIGVSIKNGP
TPHA0D04230        KIFILDLVHRATLAERVLGHVKMFQLLKSVVIETNDASN--NH----KTIAIGVSVKNGP
KNAG0B00830        EIYLLDLHLGSVLSHNKFAQLKQVELIAGA-----------RD----GSFAIALSHGPQD
KAFR0C01940        TIYALNLHLSSVISMSELLNLKWFKLIDNLS----------------NQFVLGLSFNNEN
                    :: ::    : :    . : .  :::                      :.: :      

CAGL0I10560g       NPTSALEIINIDVGSN-SLKDSLGKSFLRRNNQ-IQG-----QLKNLF--------PEPK
TBLA0C04460        TSASALELINIEVGSG-TLKDSLGKGVSKKLSEGSHS-----DLKPLF----DENDEKSL
KLLA0E04665g       NPTSYLDVINIDVGTG-TLKDAMGKGFMVKQKQ---------KLQKLF----EESNEDDD
AFR307C            NPSSALDVVTIAVGTG-TLKDSLGKGFLSGEHR-RTE-----ALKPLF-----GTDDDES
SAKL0F02838g       NATSALDIVNINVGSG-TLKDSMSKGFLTQDA--TEE-----VLNSLF-----DEQDDEL
KLTH0F14762g       NPSSSLDIINIDVGTG-TLRDSMGKGFMSREN--KSQ-----HLQPLI----STLNDTEA
Kwal_55.21222      TSTSSLDVVNIDVGTG-TLKDSMGKGFLSSKT--KVQ-----CPQSLL----GTPNDTEV
ZYRO0D10054g       NPTSALEVINVDVGTG-TLKDSLGKSFQSINDS-KTH-----NLQPLF------SDDESD
TDEL0D05570        NPTSSLEIVNVDVGTG-TLKDSLGKGFTVSNEP-ISQ-----VLKPLF------SDEDNE
YGR128C            NPTSSLEIINIDVGTN-TLKDSLGKSFQVGNND-SSV-----ILKPLF-------DDKDI
Smik_6.224         NPTSSLEIINIDVGTN-TLKDSLGKSFQAEKKD-SSV-----ILKPLF-------DDEEV
Skud_7.439         NPTSSLEIINIDVGTN-TLKDSLGKSFQVGKND-ASV-----ILKPLF-------DDEDV
Suva_7.416         NPTSSLEIINIDVGTN-TLKDSLGKSFQIGKNDTSSV-----VLKPLF-------DDENV
NDAI0G00960        NPTSSLEIINVDVGSN-TLKDSLGKCFQNLNLQ-NQIQISTQALKPLFDPNTDGDKDDDL
NCAS0E00830        NPTSSLELLNVDVGTS-TIKDSLGKSFQTSSTENNVQ-----SLKSLF-------DDEND
Kpol_480.16        SPISSLEVINVDVGSG-TLKDSLGKSFQVANVK-KNI-----PLQSLF------PEDETI
TPHA0D04230        SPITALEIINANVGTG-TLKDSLGNSFDVSKSF-KSN-----ILQPLF------TDDANL
KNAG0B00830        NAVS-LDIINLELGSR-SIKDSLGKGFATFMKE-RRSAESQVTLRPIL-------DAGDK
KAFR0C01940        YK---FELINLDLNSNFGLKDSLGKGFRNFLVD-KQSEKETLVLKSLF---SADEADEDL
                        ::::.  :.:   :.*::.: .                 . ::            

CAGL0I10560g       YELPS-------------INFPEILGKLK--NANSAEKFDETFFNLLNIKEEMFTENSRF
TBLA0C04460        IGTPVHDISNVKS-----FNFNKILADLK--SSDTISDFDKTFFESLEIKENHYTENDRF
KLLA0E04665g       VELPS-------------PDYERIIKQLH--ICKKIENFDSIFFKMLSLDKEYYTDNDRF
AFR307C            PN----------------IDFAAILAELT--SRTTPKAFDSIFYKRLGPKKEYYTEHDRF
SAKL0F02838g       DEDGTSQ-----------FDYNQILSELEK-AKSKTEKFDNVFFKSLNIKKEYYTEYDRF
KLTH0F14762g       AE----------------FNYDRILKELSK-AADNIENFDSVFFKRLGIKNNYYTDSDRF
Kwal_55.21222      QE----------------HNYTQILKDLAK-TKSNSDKFDSVFFKKLNIKNDYYTDSDRF
ZYRO0D10054g       AGDNADSDEVVA------FAYEDIFKELSK-NNKSISKFDSTFAKRLNIQEEHYTDRERF
TDEL0D05570        AEDEDNKFEH--------FDFNQIYQHLEK-NKQSISSFDRIFLRELNIKREHYTELDRF
YGR128C            NDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDDIFFKELKIKEEHYTEKDRY
Smik_6.224         TENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKDLKIKEEHYTEKDRF
Skud_7.439         TNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFDEIFFNDLKVKEEHYTEKDRF
Suva_7.416         ADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASFDDIFFKDLKVKEEHYTEKDRF
NDAI0G00960        FKKLVTKEQ---------FNYDEILTKLSE-NTNDIGKFDEIFFQSFNIKKEHYTENDRF
NCAS0E00830        YSDKKKQVKN--------FNYEKIYKELVD-SKNDVTKFDDIFFKSFDIKKEYYTEKDRF
Kpol_480.16        YAKGEQKS----------FDYKNILQELQN-NKNDINKFDDIFFKKLNIMKEYYTEQDRF
TPHA0D04230        VKRHD-------------FKYEAILKKLSS-TENDIKKFDDIFFGDLYIQQNYYTDNERF
KNAG0B00830        TKRS--------------FDYASILKKLTA-AAKDPAKFDQIFFKELYIVQECYTEGDRF
KAFR0C01940        HNDSDSDVEHT-------FNYDKIIVDLNK-AVKNPSKFDKIFFEKFNIKKEHYTEADRF
                                          :   :          **  *   :    : :*: .*:

CAGL0I10560g       LNDQRFLASVLDLIFTKIDY------NKSCPRSLMFLLTHPLFPKEKAIGLLTKVKSNSR
TBLA0C04460        ISDQDFIANTIDLIFKKF--------DTEFPKAFTFLLTHPLFPIKLTVGLLDKLKDHPR
KLLA0E04665g       LNDSDLLTQIIDCLFLNF--------KDEYPKALTYLLTHPLFPPVHAKGLLTKLKNNPR
AFR307C            INNSEFLAGILDHIFATF--------ADEFPKALIYLLTHPLFPSSHTKGLLPKLKAHPR
SAKL0F02838g       FNSQGFLDKVLSLIFENF--------NKEYPRALTYLLTHPLFPAKHATCLLSKFKEHPR
KLTH0F14762g       VNDREFLEDVSTLIFKSF--------KSEYPKALTYLLTNPLFPVSHTHNLLQKLKDHPR
Kwal_55.21222      LNDQEFLGNSLKLIFENF--------QSEYPKALTYLLTHPLFPITCTHDLLQKLKDHPR
ZYRO0D10054g       ICDQEFLSKVVRLILDSF--------DQEYPRALTFLLTHPLFPTDCTRGLLERFRNHPR
TDEL0D05570        ICDRQFLSNVVHLILQNF--------QEEYPKALTFLLTHPLFPVDCTPKLLSRLREHPR
YGR128C            ISDPGFLNKVLDLIFGKFS-------GNDYPKTLTFLLTHPLFPLSRTRNLLSLLRDQPR
Smik_6.224         ISDLVFLNKVLDLIFEKFN-------GNDYPKTLTFLLTHPLFPLDRTRNLLSLLRDQPR
Skud_7.439         ISDPGFLNKVLDLIFLKFG-------GNDYPKALTFLLTHPLFPLNRTHGLLSLLRDQPR
Suva_7.416         ISDSEFLNRVLDLIFEKFN-------GNDYPKALTFLLTHPLFPLNRTHNLLSRLRDQPR
NDAI0G00960        IYNHEFFLKLIDLIFEKFGSTATTAQTNEYPKTLTFLLTHPLFPMERTQSLLSRFANHPR
NCAS0E00830        IYNHEFLVQIIDLIFETF--------KEEYPKTFTYLLTDPLFPLERTKGLLARLNNHPR
Kpol_480.16        IYDQKFLSDVLDLIFSAF--------KKDYPRALTFLLTHPLFPISHTRNLLTKFRNQPR
TPHA0D04230        IFDVTFLSDVIDLIFKNF--------QKEYPSALTFLLTHPLFPIHQTKNLLLKLREHPR
KNAG0B00830        IIDQNFLSETVGVILKNYSFEP----SSKYPAAFTYLLTHPLFPADKTRHLLSKVKQIPR
KAFR0C01940        LVNQDFLAKVIELILQNYKFDTD---GNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPR
                   . .  ::      ::             . * :: :*** ****   :  **  .   .*

CAGL0I10560g       LFKQAIVTCPNLPLQELLQELFTIKNSELVVDISMRILQDYTKDAIKEEIKKLDQVSVEN
TBLA0C04460        LFKQAIVTCPNLPLSELLFQLFTVKNGELTLDISLRVLQDYSRNDVKQEIKKLDNVDIEN
KLLA0E04665g       LFKQAIVTCPNVPLDDLLTELFNITNAELCFDITLRVLQDYKKESIKAGIRKIEKMDITN
AFR307C            LFKQAVVTCPNLPLDELLHELFTVLNDELSLDLSLRVLQEFTKEDIKQGIRELSRVDLHN
SAKL0F02838g       LFRQAIVTCPNLPLDALLHELFTVINDELCLDLSLRILQDFTKDSIKQSIKKMSKVDINN
KLTH0F14762g       LFKQAIVTCPNLLLDELVQELFTVINDELCLDLSLRILQDFNKDSIKEAIKQKSKIDVNN
Kwal_55.21222      LFKQAIVTCPNLPLSDLLQELFTVINDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNC
ZYRO0D10054g       LFKQAIVTCPNLPLDDLLSELFSINNGELCLDISLRILQDFTTDMIKDEVKKLNKVDVHN
TDEL0D05570        LFKQAIVTCPNLPLQELLSELFSIENGELSLDISLRILQDYTTDMIKQEVRKLNKIDVQN
YGR128C            LFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRILQDFTRDSIKQEMKKLSKLDVQN
Smik_6.224         LFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEMKRLSKLDIQN
Skud_7.439         LFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRVLQDFTRDSIKQEMKKLSKLDIQN
Suva_7.416         LFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEMKNLSKLDIQN
NDAI0G00960        LFKQAIVTCPNLPLPELLNELLTIKNNELSLDISLRILQDYSKDSIKQELRNLPRLEIEN
NCAS0E00830        LFKQAIVTCPNLPLNELLAELFTISNGELSLDISLRILQDYTRDSIKKELKKLPKIEVEN
Kpol_480.16        LFKQAVVTCPNLPLKELLAELFTITNGELCLDISLRILQDYTRDSIKQELKTLSKVDIQN
TPHA0D04230        LFKQAVVTCPNLPIDELLTELFSITNGELSVDISLRILQDYTKDSIKLELKNLNKIDIQN
KNAG0B00830        LYKQVIVTCPNLPLDELLTESFVIENNELSLDLSLKILQDYTKDSIKKEMKALPRVNVTN
KAFR0C01940        LYKQAIVTCPNLPLGELLADLFTIENNELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRN
                   *:.*.:*****: :  *: : : : * ** .*:::.:**::. : :*  :.   .:.:  

CAGL0I10560g       FMNFIIKMNNREAAVSDFTMFTPQIFKLLSLILDSIGLFGLEESILIQLSSIIEKEVKIA
TBLA0C04460        FIEFIITPTTE-EIQTNTP----QLFQLLSLVLDSIGLFALKGPLLERLSNYINEQVTIA
KLLA0E04665g       FLDMILNSNKADSDLKLNKP---QIFQLMSLIIDSIGLFALDDEYLEKLSSFVDAQVSVV
AFR307C            FLNFVIKDSTDVEERQKAKP---QLFQLLSLVIDAVGLLALEGDILHRLSAFIDSQVAVA
SAKL0F02838g       FIGFVINEDDDEERNKSKP----QLFQLLNLVLDSIGLFALDGESLENLHQFIENQVDIV
KLTH0F14762g       FINFVISENFEEDRIKNKP----RLFQLLSLVLDSVGLFALENEMLEKLTKYIDQQLSVV
Kwal_55.21222      FINFVMNENVDEDRVKNKP----RLFQLLNLVLDSVGLFALEDEALDKLSNYIDRQLSVV
ZYRO0D10054g       FVNFLISPKDEELIQNKSTY---ELFQLLSLVIDAIGLFALDGALLQRLSDYIDEQVYLA
TDEL0D05570        FIEFVISSNDENAIRSSH-----QLFQLLSLVLDSIGLFALDGVLLDRLADYIQERVAIA
YGR128C            FIEFITSGGEDSSPECFNPSQSTQLFQLLSLVLDSIGLFSLEGALLENLTLYIDKQVEIA
Smik_6.224         FIEFMTSTENDNSLEGFNHSQSTQLFQLLSLVLDSIGLFSLEGALLESLTSYIDKQVKIA
Skud_7.439         FIECITNTEEDGPLEGFNHNHSSQLFQLLSLVLDSIGLFSLEGALLENLTLYIDKQVKIA
Suva_7.416         FIDFITNTDEDSTLENLNHSQSSQLFQLLSLVLDSIGLFSLEGALLDNLASYIDKQVEIA
NDAI0G00960        FIDFILNDEIKDDQNSP------QLFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIV
NCAS0E00830        FIEFIIDEESDIKDTTNAP----HLFQLLSLVVDSIGLFALDNAVLERLSKYIDEQVAIA
Kpol_480.16        FIEFVIDTDSE-DKSQFNP----QLFQLLSLVLDASGLFALEEETLEKLSAYIDNQVNVA
TPHA0D04230        FIDFVIDPNNEEEKKHNE-----QLFVLLSLVLDASGLFSIEGPLLTQLSEYIDKQVEMI
KNAG0B00830        FIKFVIGNYNNSDESSVATP---QLFQLLSLVIDSIGLFALDGELLTELAGYIDNMVKIA
KAFR0C01940        FIEFVTQDEDQQVSS--------QLFQLLSLIIDSIGLFALDMDILGRISNFINEKTLVA
                   *:  :                   :* *: *::*: **:.:.   *  :   ::    : 

CAGL0I10560g       ERNVELWNIMDAKML--------SVKKSSSTAASKL--------------AENSQTPYIV
TBLA0C04460        ERSSELWHLLDTSTT-----PR-PFKNAYLKSVIG---------------NKETLSVYSV
KLLA0E04665g       SQNIELLHLAEHYT------KHSSVVNNKSNSSTNSS-------------STQPISAYTV
AFR307C            DQLVELLYLLENSST-----KKGKHLNSVTRLDESP--------------VAATIPLYSV
SAKL0F02838g       EQNIELLNLLDDTSA-----KSTSIISSYSASSST---------------TEQALPSYSV
KLTH0F14762g       KENVELYNLVEEKNF-----KN-GFGQPLGDTSTS---------------GEPVITAYSI
Kwal_55.21222      KQNVQLYNLVDERNF-----KN-ILGQHHADSLSV---------------GEGAITAYSV
ZYRO0D10054g       ERNARLWNLLDTRNK-----NR-GATGSLAGSSRA---------------KEQTLPKYTV
TDEL0D05570        ERNSKLCHLLDDKQN-----SR-GFAKSGAGSVGS---------------TREAVPKYTV
YGR128C            ERNTELWNLIDTKGF-----QH-GFASSTFDNGTS---------------QKRALPTYTM
Smik_6.224         ERNTELWNLIDIKSS-----QH-GFTNLAFESASS---------------QKQALPTYTM
Skud_7.439         ERNTELWNLIDIKGS-----QH-GFATLSSGSTTS---------------QKQALPAYAM
Suva_7.416         ERNTELWNLVETKGS-----QH-GFTNMNSDSRTS---------------QKQALPTYTM
NDAI0G00960        EKNTELWYLIDSNNNIFSHNKK-DNSFSSASASTNSKSNNISSNNKKSFTQKEALPMYSV
NCAS0E00830        QSNTELWHLLDYSNVLAYKNDK-FVTSTSKDSNTSLKL------------QEEVLPKYSV
Kpol_480.16        ERNNRLWHLLDENSD-----KR-STLNQANDQNVL---------------QTKSLSAYSV
TPHA0D04230        EKSNKLWHLIDGTLG-----KR-NNHYQTSGATVP---------------EIKALTAYSV
KNAG0B00830        EMNTELWNLLEFRTN-----KASVAGSNRSKYVKT---------------QKKVFPPYLV
KAFR0C01940        KQNSELLHLLDYNPSKQSSARQ-SSKLINNNNKSL---------------HRKTLPTYTV
                   .    *  : :                                            . * :

CAGL0I10560g       EYIDI
TBLA0C04460        DYLDI
KLLA0E04665g       DYLEC
AFR307C            EYLDS
SAKL0F02838g       EYL--
KLTH0F14762g       EQLEL
Kwal_55.21222      EQLEL
ZYRO0D10054g       EYLEL
TDEL0D05570        EYLDL
YGR128C            EYLDI
Smik_6.224         EYLDI
Skud_7.439         EYLDI
Suva_7.416         EYLEI
NDAI0G00960        DYLEL
NCAS0E00830        EYLDL
Kpol_480.16        EYLEL
TPHA0D04230        EYLEL
KNAG0B00830        DHLEI
KAFR0C01940        EHLDL
                   : :  

FASTA FORMAT for MUSCLE Version 3.6

>CAGL0I10560g
-MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADS-FTPDSNSVLLGISGSSISKYVITP
TPRLIFNVPIPSTHLVSACNMGTYSETSTVSSDPQATADETTDTAPTSTNTVE-------
--ETKHYEIWCYALSANNKTHTLNCLIREVD-----------------NNNTSITENNPQ
FNAKFKEQIINIEVDTKHK---VIVILFETGLVQFYDLQLKLLNSINTPYRDIKIVKTFE
-ENGLEYMLLISDLKDQK--VALQLYEVST----EEKKVKELTSSIIENFNLQDSLLCYQ
FGRIYR--L-FKDEIEVYSIPSLQLNSKVKIPFLSEIEDKNCLISLKPIATNRVLLTVKN
KIYLLDLLHKSILSEREVSHMKTFQILKTAM--NRDGSE--SK----LTLALGISTKNGQ
NPTSALEIINIDVGSN-SLKDSLGKSFLRRNNQ-IQG-----QLKNLF--------PEPK
YELPS-------------INFPEILGKLK--NANSAEKFDETFFNLLNIKEEMFTENSRF
LNDQRFLASVLDLIFTKIDY------NKSCPRSLMFLLTHPLFPKEKAIGLLTKVKSNSR
LFKQAIVTCPNLPLQELLQELFTIKNSELVVDISMRILQDYTKDAIKEEIKKLDQVSVEN
FMNFIIKMNNREAAVSDFTMFTPQIFKLLSLILDSIGLFGLEESILIQLSSIIEKEVKIA
ERNVELWNIMDAKML--------SVKKSSSTAASKL--------------AENSQTPYIV
EYIDI
>TBLA0C04460
-MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLGISGSGISQYIINP
TPKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENT
DVTKRSVELWAYGLVANK-SNTLNISVKTTG---------------LDEFSTTPGEIIRK
KTIKVDSKVVNIKIFKEFK---TIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFT
-ESKQNFLLILSNIDEEKSSVCFKLYQLRLDS--DSNQVSELSFSILQDFDLSKSKLSYQ
FGKLYR--L-TGSELFVYSLPQCQLLQNISLAEI--FPNTIDVSSIKPVANNRLVLAINN
VVYLIDTLHRSILAEREFTHVKTFQLLQSATIG--DSNI--TQ----RTIAIGVSTKSGP
TSASALELINIEVGSG-TLKDSLGKGVSKKLSEGSHS-----DLKPLF----DENDEKSL
IGTPVHDISNVKS-----FNFNKILADLK--SSDTISDFDKTFFESLEIKENHYTENDRF
ISDQDFIANTIDLIFKKF--------DTEFPKAFTFLLTHPLFPIKLTVGLLDKLKDHPR
LFKQAIVTCPNLPLSELLFQLFTVKNGELTLDISLRVLQDYSRNDVKQEIKKLDNVDIEN
FIEFIITPTTE-EIQTNTP----QLFQLLSLVLDSIGLFALKGPLLERLSNYINEQVTIA
ERSSELWHLLDTSTT-----PR-PFKNAYLKSVIG---------------NKETLSVYSV
DYLDI
>KLLA0E04665g
-MASISQPFRLSALPKIPSLNNYANQTDYLQVVDN-LSPSANKVNIGISGSSISQYLINP
TPKLVFNLPIPSTNIVTACDVVE-------------------------------------
--DAANTEVWCYGLEARK-VSHLHLATKPMI---------------QDAVSSSNAEITSQ
FKYKLKSEVVSIKIYSKAE---KVLVILRNGLIQTFDYELKLSNTIDISYDDIRFVQFFQ
DGQGNDFFFVLCQLSDEK--ICYKLFQVRS----ESVSCIELNSIILENYTLENAKLCFE
FGKLYV--LKNSNELSIYQLPHLQLQTSIQLPFI----SKDAVVSIKPVSSNRVLLTADN
TIYLVDLLYNAILFQKDLQNIKAIQLLSTAVVQ-ENSED--NR----KTIALDVTTKNGA
NPTSYLDVINIDVGTG-TLKDAMGKGFMVKQKQ---------KLQKLF----EESNEDDD
VELPS-------------PDYERIIKQLH--ICKKIENFDSIFFKMLSLDKEYYTDNDRF
LNDSDLLTQIIDCLFLNF--------KDEYPKALTYLLTHPLFPPVHAKGLLTKLKNNPR
LFKQAIVTCPNVPLDDLLTELFNITNAELCFDITLRVLQDYKKESIKAGIRKIEKMDITN
FLDMILNSNKADSDLKLNKP---QIFQLMSLIIDSIGLFALDDEYLEKLSSFVDAQVSVV
SQNIELLHLAEHYT------KHSSVVNNKSNSSTNSS-------------STQPISAYTV
DYLEC
>AFR307C
-MAYIAQPFRLANLPKISSLNNYAQQTSYLQVADV-LEPTSNTVTVGVSGSSISQYVINP
TPKLVYNIPIPSTNVVTGCDVLA-------------------------------------
--MSDGAELWSYALTANGKVHTLHAVLRKAGA--------------APQETGLDASEDEH
FKQTLKGRVVRVRILSACK---RIMVVLDCGLIQTYDYQLQLLHSLDISYTNVGLVEYFT
DSAGKDYMFVLCDIQNKK--TCYKLFQLNHSA--ENLPITELNSVILEDFALAESKMVYQ
FGKLYR--L-VDSKMYVYSLPHFQLSHCVPLPFV----RKDDQVSLQAISTNRLLLTCCN
KIFLLDLLHNAILYERELSNIKFFQLLRAAVIPGTTPGE--SN----RTFAIGVSTKQGS
NPSSALDVVTIAVGTG-TLKDSLGKGFLSGEHR-RTE-----ALKPLF-----GTDDDES
PN----------------IDFAAILAELT--SRTTPKAFDSIFYKRLGPKKEYYTEHDRF
INNSEFLAGILDHIFATF--------ADEFPKALIYLLTHPLFPSSHTKGLLPKLKAHPR
LFKQAVVTCPNLPLDELLHELFTVLNDELSLDLSLRVLQEFTKEDIKQGIRELSRVDLHN
FLNFVIKDSTDVEERQKAKP---QLFQLLSLVIDAVGLLALEGDILHRLSAFIDSQVAVA
DQLVELLYLLENSST-----KKGKHLNSVTRLDESP--------------VAATIPLYSV
EYLDS
>SAKL0F02838g
-MASISQPFRLTALPKIASLNNFSTQTDYLQVANT-LTPSANKINIGVSGSSISQYIINP
TPKLVHNLSIPSTSIVTACDVSEIQQNEG-------------------------------
--DTETQEVWCYALVANK-SFTLNTIIKPLT---------------ADAPSVNSTQTFEN
YKVSIKHKVASVKIFPSRK---TIIAVLQNGLVQTFDFQLKLLHSADISYGNISLVKYFT
NEVLQDFMIVLTDLNDDK--VCYKLFEIIHHD--SNVPLKELNSVILEGFSLQNSKTFYQ
FGKIYT--L-SNGKISIYSLPHFQLSNTINLPFV----THENVVSFKPISTNRALLTVDN
RIYLLDLLHNAILSQRELTHVKTFQLLTTAIIPGNTA-E--NN----KTIAIGVSTKSDN
NATSALDIVNINVGSG-TLKDSMSKGFLTQDA--TEE-----VLNSLF-----DEQDDEL
DEDGTSQ-----------FDYNQILSELEK-AKSKTEKFDNVFFKSLNIKKEYYTEYDRF
FNSQGFLDKVLSLIFENF--------NKEYPRALTYLLTHPLFPAKHATCLLSKFKEHPR
LFRQAIVTCPNLPLDALLHELFTVINDELCLDLSLRILQDFTKDSIKQSIKKMSKVDINN
FIGFVINEDDDEERNKSKP----QLFQLLNLVLDSIGLFALDGESLENLHQFIENQVDIV
EQNIELLNLLDDTSA-----KSTSIISSYSASSST---------------TEQALPSYSV
EYL--
>KLTH0F14762g
-MPSISQPFRLTALPKIASLNNYATQGNYLQVADT-LTPTTNNINVGVSGSAVSQYIINP
TPKLVYNQPISSTNVVSACAVAEITTTS--------------------------------
--EKDSQEVICYGIQSNR-VYSLCATIKPVS---------------STASDSSFGETYAA
HKVSVSDQIVNLKVFPDTK---SIVAVLRSGLIQFFDFELKLQHSLDSSYKNVSYVQHFT
SESGQRYTFLLSDIDGHK--VSFKLFEIGQSD--SATPATELSSVILENMCLKDSQIFYQ
FGQVYR--L-HGNAVSIYNLPHFQHSRTIELPFL----APESIISFKPISTNRALLTSDN
KIFLLDLLHNAILSQREMGHVKIFQLLETAVIPGNST-L--NN----KTIALGVSIKHGS
NPSSSLDIINIDVGTG-TLRDSMGKGFMSREN--KSQ-----HLQPLI----STLNDTEA
AE----------------FNYDRILKELSK-AADNIENFDSVFFKRLGIKNNYYTDSDRF
VNDREFLEDVSTLIFKSF--------KSEYPKALTYLLTNPLFPVSHTHNLLQKLKDHPR
LFKQAIVTCPNLLLDELVQELFTVINDELCLDLSLRILQDFNKDSIKEAIKQKSKIDVNN
FINFVISENFEEDRIKNKP----RLFQLLSLVLDSVGLFALENEMLEKLTKYIDQQLSVV
KENVELYNLVEEKNF-----KN-GFGQPLGDTSTS---------------GEPVITAYSI
EQLEL
>Kwal_55.21222
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------MSFGPISINRALLTCDN
KVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSS-S--NN----STIAIGVATKPGN
TSTSSLDVVNIDVGTG-TLKDSMGKGFLSSKT--KVQ-----CPQSLL----GTPNDTEV
QE----------------HNYTQILKDLAK-TKSNSDKFDSVFFKKLNIKNDYYTDSDRF
LNDQEFLGNSLKLIFENF--------QSEYPKALTYLLTHPLFPITCTHDLLQKLKDHPR
LFKQAIVTCPNLPLSDLLQELFTVINDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNC
FINFVMNENVDEDRVKNKP----RLFQLLNLVLDSVGLFALEDEALDKLSNYIDRQLSVV
KQNVQLYNLVDERNF-----KN-ILGQHHADSLSV---------------GEGAITAYSV
EQLEL
>ZYRO0D10054g
-MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVSSD-ISPNSNKITIGISESAISQYILNP
TPKLLSNISIPSTNVVSACDVAT-------------------------------------
--LADDKEIWCYCVKSGK-SHFLNASVKPVDA--------------DTVLDTDGGDKTED
FKIKMDSKVVGIKIIPDYK---AIVVVLESGLIQYYDFQLQKLSSLDISYQNVKVVNYFS
-ENGQNFMFVLSGFENNK--VCFKLFELLYHDGKRHTPIKELSTTILENFNLDQSKLCYQ
SGKLYQ--L-EGSTIKTYALPQCHLVQTTHLPMI--LDPNSQKVSLAPVSTNRILLTVNN
QVYLLDLVHSSVLSERTLTHAKTFQLLRSAPLNVSSSLK--GSEFATRTLAIGVTTKNGN
NPTSALEVINVDVGTG-TLKDSLGKSFQSINDS-KTH-----NLQPLF------SDDESD
AGDNADSDEVVA------FAYEDIFKELSK-NNKSISKFDSTFAKRLNIQEEHYTDRERF
ICDQEFLSKVVRLILDSF--------DQEYPRALTFLLTHPLFPTDCTRGLLERFRNHPR
LFKQAIVTCPNLPLDDLLSELFSINNGELCLDISLRILQDFTTDMIKDEVKKLNKVDVHN
FVNFLISPKDEELIQNKSTY---ELFQLLSLVIDAIGLFALDGALLQRLSDYIDEQVYLA
ERNARLWNLLDTRNK-----NR-GATGSLAGSSRA---------------KEQTLPKYTV
EYLEL
>TDEL0D05570
-MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADD-IEPTSNRITIGISESAISQYVLNP
TPKLVLSIPIPSTNIVTACDVA--------------------------------------
--RSDEQEIWCYALQAGK-VCTLNVASKVSH-------------------AENGVNSDDV
LKVKVDDQAVGVHVNGKDK---TIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVSVTKFFT
-EGANDFLFILCSLPEDK--VCFKLFELSLPNY-NQVPIKELSSIILEDFSLATSKICYQ
SGRLYR--L-IGHEVLVYALPQCQLVQAVTLPMV----QGADVISMKPISSNRILVTADN
KIYLLNLTHNSILFQRELTHLKSFQLLKSAVIDSRVSSSLPNQ----KTFVIGVGTKHGK
NPTSSLEIVNVDVGTG-TLKDSLGKGFTVSNEP-ISQ-----VLKPLF------SDEDNE
AEDEDNKFEH--------FDFNQIYQHLEK-NKQSISSFDRIFLRELNIKREHYTELDRF
ICDRQFLSNVVHLILQNF--------QEEYPKALTFLLTHPLFPVDCTPKLLSRLREHPR
LFKQAIVTCPNLPLQELLSELFSIENGELSLDISLRILQDYTTDMIKQEVRKLNKIDVQN
FIEFVISSNDENAIRSSH-----QLFQLLSLVLDSIGLFALDGVLLDRLADYIQERVAIA
ERNSKLCHLLDDKQN-----SR-GFAKSGAGSVGS---------------TREAVPKYTV
EYLDL
>YGR128C
-MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINP
TPKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQ-----------
--KKRNVEIWAFGLMVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQ
YKIKAKAKVMSIKIDTKNS---LVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFT
-ENGTEYVFVLCPLQDDK--VCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQ
FGKLYK--L-NQGKIYIYSLPHCQLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNN
VIYLLDLLHCSTLSQRELTHVKTFQLLKSAVINSEK-SH--NS----KTIAIGISTKNGP
NPTSSLEIINIDVGTN-TLKDSLGKSFQVGNND-SSV-----ILKPLF-------DDKDI
NDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDITSFDDIFFKELKIKEEHYTEKDRY
ISDPGFLNKVLDLIFGKFS-------GNDYPKTLTFLLTHPLFPLSRTRNLLSLLRDQPR
LFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRILQDFTRDSIKQEMKKLSKLDVQN
FIEFITSGGEDSSPECFNPSQSTQLFQLLSLVLDSIGLFSLEGALLENLTLYIDKQVEIA
ERNTELWNLIDTKGF-----QH-GFASSTFDNGTS---------------QKRALPTYTM
EYLDI
>Smik_6.224
-MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINP
TPKLIFDYPIPSTNIITACNAGEAQVNIE--------DKDNNEKVINSQ-----------
--TKRNIEIWSFGLMVNKGNYTLNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQ
YKIKAKAKVMSIKIDTKNN---LIIAILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFT
-ENGIEFIFVLCPLQDDK--VCYKLLELTDYENRENSPIKELSSTIIEGFSFDDSKLCYQ
FGKLYK--L-NKGKIYVYSLPHCQLQQVIELPLINNSDFEHDLISFQPVSVNRVLLTVNN
IVYLLDLLHCSTLGQRELSHVKTFQLLNTAVINSEK-SH--SS----KTIAIGISTKNGA
NPTSSLEIINIDVGTN-TLKDSLGKSFQAEKKD-SSV-----ILKPLF-------DDEEV
TENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKDLKIKEEHYTEKDRF
ISDLVFLNKVLDLIFEKFN-------GNDYPKTLTFLLTHPLFPLDRTRNLLSLLRDQPR
LFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEMKRLSKLDIQN
FIEFMTSTENDNSLEGFNHSQSTQLFQLLSLVLDSIGLFSLEGALLESLTSYIDKQVKIA
ERNTELWNLIDIKSS-----QH-GFTNLAFESASS---------------QKQALPTYTM
EYLDI
>Skud_7.439
-MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINP
TPKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQ-----------
--TKRNIEIWSFGSMVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQ
HKIKTKAKVMNIKIDAKNS---LIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFT
-ENGTDFVFVLCPLEDDK--VCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQ
FGKLYK--L-NQGKIYVYSLPHCQLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNN
IIYLLDLLHCSILNHRELTHVKTFQLLKSALIDSEK-SH--NS----KTIAIGISTKNGP
NPTSSLEIINIDVGTN-TLKDSLGKSFQVGKND-ASV-----ILKPLF-------DDEDV
TNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNNDIASFDEIFFNDLKVKEEHYTEKDRF
ISDPGFLNKVLDLIFLKFG-------GNDYPKALTFLLTHPLFPLNRTHGLLSLLRDQPR
LFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRVLQDFTRDSIKQEMKKLSKLDIQN
FIECITNTEEDGPLEGFNHNHSSQLFQLLSLVLDSIGLFSLEGALLENLTLYIDKQVKIA
ERNTELWNLIDIKGS-----QH-GFATLSSGSTTS---------------QKQALPAYAM
EYLDI
>Suva_7.416
-MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLGISGSSISQYIINP
TPKLTFDYPIPSTNIITACNAVQGQVEIENDTKNSDNDKTDHE-VTNFQ-----------
--SKRDVEIWSFGLMVNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQ
YKIKTKDKVMNIKIDAKNS---LVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFT
-ENGTEFVFVLCPLEDDK--VCYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQ
FGKLYK--L-NQGKIHVYSLPHCQLQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNN
TIYLLDLLHCSILNQRELTHVRTFQLLRSAVIDSEK-SQ--NS----KTIAIGISTKNGP
NPTSSLEIINIDVGTN-TLKDSLGKSFQIGKNDTSSV-----VLKPLF-------DDENV
ADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVASFDDIFFKDLKVKEEHYTEKDRF
ISDSEFLNRVLDLIFEKFN-------GNDYPKALTFLLTHPLFPLNRTHNLLSRLRDQPR
LFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEMKNLSKLDIQN
FIDFITNTDEDSTLENLNHSQSSQLFQLLSLVLDSIGLFSLEGALLDNLASYIDKQVEIA
ERNTELWNLVETKGS-----QH-GFTNMNSDSRTS---------------QKQALPTYTM
EYLEI
>NDAI0G00960
-MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINP
TPKLIFNYPIPSTNIVTACDVLENDN----------------------------------
--DNTNNEVWCFGLVANK-TYTLTLITKDKQKSSATMEDD------EDVVDVIDTTIKDE
FNVKLDSKIVDIKIIKKKADDISIMIVLENGLIQFFNSSLKLLNTVKINYKNVKFVEHFK
-EDNKDFMFTICDLGDNNK-VCIKLFQI------NNDSAIELNSIIMENFNGQNAKFCYQ
FGKFYK--L-TNNNLMVYSLPQFQLEHTTTIPMI---KTDDQIVSMKPISTNRILLTINN
KIYLLDLIHNSILSERELTHLKSLQLLRSAVIGKGE--N--NN----KTITIGVSTKFGV
NPTSSLEIINVDVGSN-TLKDSLGKCFQNLNLQ-NQIQISTQALKPLFDPNTDGDKDDDL
FKKLVTKEQ---------FNYDEILTKLSE-NTNDIGKFDEIFFQSFNIKKEHYTENDRF
IYNHEFFLKLIDLIFEKFGSTATTAQTNEYPKTLTFLLTHPLFPMERTQSLLSRFANHPR
LFKQAIVTCPNLPLPELLNELLTIKNNELSLDISLRILQDYSKDSIKQELRNLPRLEIEN
FIDFILNDEIKDDQNSP------QLFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIV
EKNTELWYLIDSNNNIFSHNKK-DNSFSSASASTNSKSNNISSNNKKSFTQKEALPMYSV
DYLEL
>NCAS0E00830
-MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNP
TPKLIFNFPIPSTNIVTACNVFEQ------------------------------------
--KGSSEETWCFATMANK-TSTLNLINKNQYQTNEEE---------SGDSAPSDSSVTSE
FKIKADDHVVDIKILNKKK----IIVVLKNGKIQTYDFELKLLNSINMAYNNVRFVEHFH
-EDGKDFMFVLCDLENDK--VCLKLFQINENIETINDSAIELTSTILENFPLENAKFCYQ
FGKFYK--L-TDDKILVYSLPQFQFQYSITLPMITDLKEGERVVSFKPISPNRILLTVNN
KIYLLDLIHNSILSERELTHLKTFQLLKTAVVDTNI--N--QN----RTLAIGVSTKFGS
NPTSSLELLNVDVGTS-TIKDSLGKSFQTSSTENNVQ-----SLKSLF-------DDEND
YSDKKKQVKN--------FNYEKIYKELVD-SKNDVTKFDDIFFKSFDIKKEYYTEKDRF
IYNHEFLVQIIDLIFETF--------KEEYPKTFTYLLTDPLFPLERTKGLLARLNNHPR
LFKQAIVTCPNLPLNELLAELFTISNGELSLDISLRILQDYTRDSIKKELKKLPKIEVEN
FIEFIIDEESDIKDTTNAP----HLFQLLSLVVDSIGLFALDNAVLERLSKYIDEQVAIA
QSNTELWHLLDYSNVLAYKNDK-FVTSTSKDSNTSLKL------------QEEVLPKYSV
EYLDL
>Kpol_480.16
-MPSFSQPFRLAVLPKILSLSNVETQISSLQIADD-FSLESNKITIGISGSTISQYIINP
TPSLVFNVPIPSTNNVTACNIGHFVSDT--------------------------------
--DGSKLECWAYGLSYNK-NHTLNISIKTSD---------------DDKYATSGGEVVET
YSQKCDDKIEHIKINEKEK---VIVVVLKNGLIQFYDFTLKLLKSVNVMYSDISFVEHFE
-EDGKQFAIILSNIEGKK--ISFKLYELFTN---DKTSINELSSTILEDADLGESQICYQ
FGKIYR--L-FEDRLYIYNLPQCQLQQTIELPFI--QKKDSDVLSFSPIANNRILLTVNN
KIYLLDLVHNSILAERDLSHVKVYQLLKSIVVPSKGENK--NS----KTIAIGVSIKNGP
SPISSLEVINVDVGSG-TLKDSLGKSFQVANVK-KNI-----PLQSLF------PEDETI
YAKGEQKS----------FDYKNILQELQN-NKNDINKFDDIFFKKLNIMKEYYTEQDRF
IYDQKFLSDVLDLIFSAF--------KKDYPRALTFLLTHPLFPISHTRNLLTKFRNQPR
LFKQAVVTCPNLPLKELLAELFTITNGELCLDISLRILQDYTRDSIKQELKTLSKVDIQN
FIEFVIDTDSE-DKSQFNP----QLFQLLSLVLDASGLFALEEETLEKLSAYIDNQVNVA
ERNNRLWHLLDENSD-----KR-STLNQANDQNVL---------------QTKSLSAYSV
EYLEL
>TPHA0D04230
-MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADD-FTLDSNKITIGVSGCAVSQYVINP
TPNVSQTVPIPSTNNVTACNVAQYKDAD--------------------------------
--TEELFEIWVYNLAVNK-KNTLHVAIKTVD---------------PDKFSTTQSDALET
YTVKCDASVVGIKINKEDK---TIVVTLGNGFIQIFDFKLKLLNSVNTSYDNIYFSEHFV
-ENKKSFAIILSTIEGNK--LSYKLYELFGQ---DKTSIKELSSTILEDIQCKDSKISYQ
FGKLYR--L-YKNQMFVYSLPQCQLVDTITLPQI--DLKKSQAISFKPVSNNRILLTVDN
KIFILDLVHRATLAERVLGHVKMFQLLKSVVIETNDASN--NH----KTIAIGVSVKNGP
SPITALEIINANVGTG-TLKDSLGNSFDVSKSF-KSN-----ILQPLF------TDDANL
VKRHD-------------FKYEAILKKLSS-TENDIKKFDDIFFGDLYIQQNYYTDNERF
IFDVTFLSDVIDLIFKNF--------QKEYPSALTFLLTHPLFPIHQTKNLLLKLREHPR
LFKQAVVTCPNLPIDELLTELFSITNGELSVDISLRILQDYTKDSIKLELKNLNKIDIQN
FIDFVIDPNNEEEKKHNE-----QLFVLLSLVLDASGLFSIEGPLLTQLSEYIDKQVEMI
EKSNKLWHLIDGTLG-----KR-NNHYQTSGATVP---------------EIKALTAYSV
EYLEL
>KNAG0B00830
MSASISQPFTIANVPRQASQTK-------VLISQHSLTSNANTLDVAVSKYSISQYIINP
TPKLVNSKAIPSNLTVTAFDNG--------------------------------------
----------VYATQSNNKSFCLYL--------------------------------DES
HQIPLKSAVVNCLSEKIHDESVVTTAILQDGTVQKYKGGEQVFAK-HLPLKDIKQVEFID
----GQYALIVAA-------QSTALYELE-----NLTELRVSTTLHFEQFK----QIRQH
LGKIYQFDL-ATNDFKIFELTTLNEIGVVNIPFL--SASKGAPLTFTVVGDSRVCLALAN
EIYLLDLHLGSVLSHNKFAQLKQVELIAGA-----------RD----GSFAIALSHGPQD
NAVS-LDIINLELGSR-SIKDSLGKGFATFMKE-RRSAESQVTLRPIL-------DAGDK
TKRS--------------FDYASILKKLTA-AAKDPAKFDQIFFKELYIVQECYTEGDRF
IIDQNFLSETVGVILKNYSFEP----SSKYPAAFTYLLTHPLFPADKTRHLLSKVKQIPR
LYKQVIVTCPNLPLDELLTESFVIENNELSLDLSLKILQDYTKDSIKKEMKALPRVNVTN
FIKFVIGNYNNSDESSVATP---QLFQLLSLVIDSIGLFALDGELLTELAGYIDNMVKIA
EMNTELWNLLEFRTN-----KASVAGSNRSKYVKT---------------QKKVFPPYLV
DHLEI
>KAFR0C01940
-MPSISQPFAITTVPKQSSTSP-------IIVSSHSLTANSNSLDVAISKYAVSKFVINP
TPKLINSIPIPSNEVVTAFHDT--------------------------------------
----------VFATATVNQKYTLHLNGK--------------------------------
-KVPIQSKIM--KLFSDES---QTITILENGTIEKYDSNL-IKSTYKTPHKDLVNVEFIE
----SKYALLISQ-------NSISLYDINTMI--ELRNVANVQDIVDSDFKSLDGKL-YQ
FNQ-------KLSKFDIWEISSMTIVNIITIPFIN--DVEKDVVSFTVVDDNCVVMAVNS
TIYALNLHLSSVISMSELLNLKWFKLIDNLS----------------NQFVLGLSFNNEN
YK---FELINLDLNSNFGLKDSLGKGFRNFLVD-KQSEKETLVLKSLF---SADEADEDL
HNDSDSDVEHT-------FNYDKIIVDLNK-AVKNPSKFDKIFFEKFNIKKEHYTEADRF
LVNQDFLAKVIELILQNYKFDTD---GNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPR
LYKQAIVTCPNLPLGELLADLFTIENNELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRN
FIEFVTQDEDQQVSS--------QLFQLLSLIIDSIGLFALDMDILGRISNFINEKTLVA
KQNSELLHLLDYNPSKQSSARQ-SSKLINNNNKSL---------------HRKTLPTYTV
EHLDL