MUSCLE (3.8) multiple sequence alignment

TBLA0D02990        ----------------MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNST--ILY
AFR305W            ----------------MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDS--ILA
Ecym_1242          ----------------MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGV--ILA
TDEL0D05550        ----------------MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNF--MLC
Kpol_1017.9        ----------------MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILC
TPHA0D03260        ----------------MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLC
ZYRO0D10098g       ---------------------------------------MLARR-----W--------IY
KNAG0B00840        ----------------MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDY--ILS
KLLA0E04687g       ----------------MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGF--ILS
KLTH0F14718g       ----------------MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDY--ILS
Kwal_55.21217      ----------------MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDY--VVS
SAKL0F02882g       ----------------MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDF--IVS
CAGL0I10582g       ----------------MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDF--ILS
KAFR0C01930        ----------------MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNF--ILS
Skud_7.438         ----------------MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDF--ILS
Suva_7.415         ----------------MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDF--ILS
Smik_6.223         ----------------MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDF--ILS
YGR127W            ----------------MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDF--ILS
NCAS0E00840        MGNSSPQIKLINKQQTMCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDF--ILS
NDAI0G00970        ----------------MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDF--ILS
                                                             *               : 

TBLA0D02990        PYDMSKDICHDGGGDERFKSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNN-SLQSR
AFR305W            PYDMALQDA--DGLDH--GSPCGTWIGINRAGHVSVLLNLAPKDADGDHGYS---HRHSR
Ecym_1242          PYDISNSENASDASKA--ELSYGTWLGINRVGHVSVLLNLKEVSEAVNPGAG---NRKSR
TDEL0D05550        PLDKGLDSS---------GEDLGTWIGANRDGKIGTVLNLKLFSDPRGRPAV---CPESR
Kpol_1017.9        PYDMSKSNE-KN------VNKIGTWCGINEFGRVSTILNLKNDDSFQSSVPS---TKKSR
TPHA0D03260        PYDLSRNET--D------PSKFGTWCGINEFGRVSSVLNLKMDENKVEDKNV---RKKSR
ZYRO0D10098g       PLPLRCTPE-HR------AHKFGTWCGINKDGRVGTVLNLKLDQGAQRGHPL---HLSSR
KNAG0B00840        PYDMTKGLYDPG------KCVRGTWMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSR
KLLA0E04687g       PYDMAIEKK---------GQGYGTWLGINRRGRIAVILNLKIDSPLDSESVLVNGEPRSR
KLTH0F14718g       PLDTALRSN--N------KPALGTWCGVNRKGRVAVILNLRNKEPAKRIPVK---SPISR
Kwal_55.21217      PLDMTLKDN--N------EPNLGTWCGANRNGRIAVILNLRTGNTNQTKTK----RIVSR
SAKL0F02882g       PFDMSITTK---------GRNFGTWCGVNKDGKVAVILNLRIASCGNPKNVE---CPQSR
CAGL0I10582g       PYDLARIGAGQS------NDTFGTWTGVNRKGRVATVLNLRICDELDMKRMI---GERSR
KAFR0C01930        PYDMSREEN-HG------NKIFGTWLGMNKKGKIATILNLRRFSSIDLKELV---KPRSR
Skud_7.438         PYDLAKTSK--E------KQIFGTWSGINREGKLATILNLKLDGQ---RDTI---KSKSR
Suva_7.415         PYDVAKTSM--E------KQIFGTWSGINKEGKLATILNLKMDDQ---RSCT---KSKSR
Smik_6.223         PYDLARTSK--E------GQEFGTWSGINKEGKLATILNLKLGSE---RSTI---KSKSR
YGR127W            PYDLAKTSA--E------KQIFGTWSGINKEGKLATILNLKLDNE---QNNT---KSRSR
NCAS0E00840        PFDMAKSCELHE------KKIFGTWIGINRDAKIATILNLKLESQLDLKQLV---KPQSR
NDAI0G00970        PYDMAKECKYND------KKVFGTWLGINKDGKIATVLNLKLNKSLSLKQLV---APKSR
                   *                     *** * *  ..:  :***                  **

TBLA0D02990        GLIPIKYLCDF--DHG-FQDWNTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMG
AFR305W            GAVTMEYLKDF--DHNNWDSWNTYEKFGAHFPTLY-KTKLFTHFYGDVVNSQFSVINSLG
Ecym_1242          GNVTVAFLRDL--SNGNWDKWNNYEKFSEHFAALD-DTQSFTLFYGDIKTGDFGLIDSYK
TDEL0D05550        GKIPVSFLSSR--GAN-FKDWDTYDKFCHQFQGLE-FTRDFNFFYGDCSIGDYRVIDSLG
Kpol_1017.9        GALPIKFLDNK--ETDSLLNWDSYEKFVKEYPFVK-ETGDFNFFYGDVRIGKYNVIDSIG
TPHA0D03260        GYLPVKFLDNR--KENSFNDWNSYSKFLKQYPDLE-KTGSFNLFIGDVKKQEYALIDSFG
ZYRO0D10098g       GKVPTAFLSQH--DLD-WEQWNSYNKFANQFSELD-NTGDFNFFYGDCKNGQYKIIDSLR
KNAG0B00840        GLIPFMFLSDR----GFIDQWDSFEKFRDRYPDLE-KSGDFNLFIGDIRQQDYKVLDSSG
KLLA0E04687g       GIVPLQFLQQE--DNAPFDNWDSWEKFNGQHGNLR-RTGPFTLFYGDAKSDEYNVIDYLK
KLTH0F14718g       GSVPMKYLMDR--GPS--TDWNSFEKFVSKYPQIT-EC-EFNMFYGDCIAGEYTCIDSLG
Kwal_55.21217      GNVTMRYLTDK--QPA--SDWNSYAKFASKCPDIK-SC-EFNMFYGDCKSGDYTAIDSSG
SAKL0F02882g       GIVPMKFLAGK--DVD-FNNWDSYEKFSHHYPGIE-KTGNFNLFYGDCSKGEYKLISSLS
CAGL0I10582g       GALPFVFLNDR--QGN-FEDWDTYAKFCKCYPDIK-RTGDFNLFYGDFKEGRYALIDSLG
KAFR0C01930        GLIPFTFLYSDWTNEDSFEEWETFEKFKSKYPFLQ-SSGDFNFFYGDIKEGNYRIIDSLG
Skud_7.438         GLLPFTFLSTH--KAD-FQNWDNYDKFEMNYDGLN-TTGDFNFFYGDVIEKQYKLIDSLG
Suva_7.415         GMLPFTFLTSH--KAR-FQDWDDYNKFEKHYDGLR-TTGDFNFFYGDVIEKRYKVIDSLG
Smik_6.223         GLLPYIFLSNH--EAN-FKDWDSYSKFGNHYDGLK-ATGDFNFFYGDVIEKQYKVIDSLG
YGR127W            GLLPFIFLSIH--KAD-FEDWDNYKKFEGHYDGLK-STGDFNFFYGDVIKKQYKVIDSLG
NCAS0E00840        GMIPFVFLSEH--DSD-FNKWDTYEKFDGKYNYLR-KTGDFNFFYGDPLNDEYRIIDSKG
NDAI0G00970        GMLPFVYLSDM--TEDSFAEWDGYDNFTKKYPGLQ-STGDFNLFYGDVKRKQYRIMDSIG
                   * :.  :*           .*: : :*      :      *. * **     :  :.   

TBLA0D02990        QSQRVLDEENP-----YMVVSNINWGDPKKMGE--------------------WSKIKNG
AFR305W            QTLDPF-SQSP-----YYVVSNGPSDGAKALGQ--------------------WPKVVEG
Ecym_1242          RSMNPFSSKQP-----YVVISNSRVNCEDEGPR--------------------WKKVVEG
TDEL0D05550        NTTKVLGKTNE----KYIVVSNDIFQGESNKNRV-------------------WDKISLA
Kpol_1017.9        STNEVLTVDNP-----YLVISNDKFGKSNGKSTKE------------------WEKITLA
TPHA0D03260        QTKRILDGKDE-NGKSSVVISNSEFISNDKER---------------------WHKISNG
ZYRO0D10098g       QTHDVLTNNESQDDSSYMVVSNDVYRYQGEET---------------------WPKVQLA
KNAG0B00840        NTFSVLNETTG----MNMVVSNDTYKEFNENDISE------------------WNKVKLG
KLLA0E04687g       HSTNPFEKME------HMVISNDIFHCAVGEHTSR------------------WNKTEYG
KLTH0F14718g       YSSEALTANKP-----NLVLSNDHIDSSSR-----------------------WPKVQKA
Kwal_55.21217      HSFEVLRSQNP-----YLVISNDSIESATK-----------------------WPKIELA
SAKL0F02882g       ETTDGFQNDDG-----YMVVSNDLISSKKK-----------------------WGKISLA
CAGL0I10582g       NTHPLFSKPGK----GYLVISNNIHDKLHLQSQDIN------------SGPEEWGKIKKG
KAFR0C01930        NTFKVLDNNNR-----NMIISNDLYQHKDEYEGKP-----------------TWGKIKIG
Skud_7.438         RTFNVLDSTCKSNLNSYMAVSNGEFYNSPSISEQA------------------WKKVKVA
Suva_7.415         HTFDVLGSTCRRDPDSYMVISNGKYHNSSSISEQA------------------WEKVKIA
Smik_6.223         RTFDVLSSTCRKDLDSYMVISNGRFYNTSSIPEKA------------------WEKVKLA
YGR127W            RTFDVLSSTCRKDLDSYMVVSNGKFYDSSSIPGQA------------------WEKVKVA
NCAS0E00840        NTFKVLSGD-P-----YLTVSNDMFATGGITVERASN-----------NRIAEWRKIKFG
NDAI0G00970        NTVSTLNSNCQ-----YLVVSNDVFTCNGQLGELQSNIKREGKQPCLQSKIETWGKVKLG
                    :   :             :**                               * *   .

TBLA0D02990        IKLLETLINDKLDNS--NKDELEILEDCFQISSTINL----SGKKIDGNIERLEQTKDLI
AFR305W            NQLFKKMIQ---ESL--DVSEEELLQRCFNLASYSQY-----VSNQPIGVHDDSIPKRTI
Ecym_1242          EQLLKELVK---GNL--NVSKEHLLQKCFELAGTSQF-----DVNGVIQVTDTSLPEKTI
TDEL0D05550        DQALHHLVR---EFN--DTDEDKFIQECFGIASINPFHS--KHDHGNYYMKAVELSMQTV
Kpol_1017.9        KNLLKHLP------L--CETEDDLIHKCFDIASTNTL-----NEDLIKDVDVRELMTETI
TPHA0D03260        EKLMDEFLS---KDI--R-DENSVIESCFKIASTSEL----TNEYLHSHDDILDLMTETV
ZYRO0D10098g       KKNLRKLIE---DNV--NEDQDSFISKCFQVASTSPG----LDWQSEELLKSSDVTKQSI
KNAG0B00840        KLKLHELVN---TAV--NLDKSSFIDKCFHAASFCSI-----EKSHEDISKTPEVISNTI
KLLA0E04687g       YVLLDALAK---NTT--GIAKEELLQKCFELLSNHTF---------NEGEDVDSVTTSSI
KLTH0F14718g       DILLQELVQ---SSQ--HDSEEELIEKCFALASN-------TEPAEIDNSDKEEFTCSSI
Kwal_55.21217      EKLMRDLVR---DSV--NDSEDDLLARCFSLASH-------KQDYNVDHMDKEKVTSSNI
SAKL0F02882g       KNLLRNLVE---SSV--DDTKDSILDKCFKLASHSTC-------SEKIVVKHESVTNETI
CAGL0I10582g       KQIMEEFVK---TNT--NLGKEDVIENCFKLASTNLILD--KITEEFDLVKSLGVTKETI
KAFR0C01930        AERLNKFLK---ETE--RSNEDEVLAKCFELASYCSI----DSSITREENPNKELAAETI
Skud_7.438         RDGLEKLVL---GNI--DSDEETIISNCFQLASKSSVPGTASKPNALQMLADPNVIMNTI
Suva_7.415         RDSLETLIL---DNI--ESDEETLISNCFQLASKSSLPDTGLKPDLLQMLVDPNVTMNTI
Smik_6.223         RDSLEDLVS---DNI--GLDEETIISSCFQLASKSSLPGTVSKPDVLQMLVDPNVTMSTI
YGR127W            RDSLENLVL---ENI--ESDEEKIISSCFQLASKSSLPSTISNPDVLQMVD-PNVTMNTI
NCAS0E00840        KILLQDLVE---ESK--SLDEDMLIEKCFKLASTCSV----QPKENTKFNQNSTLPMETI
NDAI0G00970        TALLQSLVN---KSIVEKQDEDTIISECFKLSSTCSV----TVEDHCKFHQNSTLPNETI
                      :  :             :  .:  **   .                          :

TBLA0D02990        FVPPLKR--SEGEVRGDAGGDAGGDAGGESVKYYGTRSQIVVLCERKSNKVTFVERILHC
AFR305W            FVPALYN--LSGQA--NLSFAAG--------MYYGTRSTIVMLVSEDGNVVT-REHVIHD
Ecym_1242          FVPTLK---AAGNSSMGVSKIVG--------EYYGTRTTIVILVD-NFNHVTMHEHVIHD
TDEL0D05550        FVPPLKT--SCDDG-LGASVPIG--------EYYGTRSQTVILVSKDRSHITYVERIIHD
Kpol_1017.9        LVPPLNVMTKEEKEKIGASLPIG--------QYYGTRSQIVILVNKNRTKVKFIERILYN
TPHA0D03260        FVPPIKLENPVEKDNIGASLPVG--------KFYGTRSQIVILVNKERTTVRYMERVLYE
ZYRO0D10098g       FVPPLKF--PPDLN-LGTTTHAG---------FYGTRSQIVLLVSKDRQKVTFVERVLHN
KNAG0B00840        FVPPLKC--QPQQD-VGLTKSGG--------LYFGTRSQLVTLVSKDRRQVTVAERILHT
KLLA0E04687g       YVPPLRI--TKGADAIGTSLPIG--------DYYGTRSQIVILVDKD-NRVTYEEHVIYE
KLTH0F14718g       FIPPVEI--PEKVD-VGASLPCG--------RFYGTRSQIVILVKRHERTISFTERVLHD
Kwal_55.21217      FVPPLEV--PKSED-LGASVPCG--------RFYGTRSQIVVLVSKEDKSIRFVEHVLYD
SAKL0F02882g       YVPPLLV--ENGQD-LDVSMPCG--------KYYGTRSQIVILVSKDQKKMTFVERVLYT
CAGL0I10582g       YVQPLLT--PPHEE-IGSPLTAG--------QYYGTRSQIVLLVDKSKTKATFIERIIYS
KAFR0C01930        YVPPLKV--CPDED-IGLTKTNG--------KYYGTRTQIVVLVHKDRKHVTLVEHTIHN
Skud_7.438         YVPPLRR--PPDDD-LGASIPDG--------DYYGTRSQIVLLVSKNSSKVTFIERILYS
Suva_7.415         YVPPLRR--PPGDD-LGASIPDG--------DYYGTRSQIVLLVSKDSSKVTFIERVLYS
Smik_6.223         YVPPLRR--PPGDD-LGASIPDG--------DFYGTRSQIVLLISKDSTKATFIERIIYS
YGR127W            YVPPLRR--PPRDD-LGASIPDG--------DYYGTRSQIVLLVSKDSTRVTFIERVLYS
NCAS0E00840        FVPPLEC--EVNDD-IGTSLSVG--------KYYGTRSQIVILISKNHERVKLVEHILYT
NDAI0G00970        LVPPLRC--KITDD-VGTSLPIG--------EYYGTRSQIVILIKRGTYEVKFAEHVIYT
                    : .:           .     *         ::***:  * *           *. :: 

TBLA0D02990        KNEDAKDNTKKIQ-----------------
AFR305W            SDQDLDSYSILNPKEQVTHRFSLQMH----
Ecym_1242          SDKDIGLSSAMNPKTKVAYEFDIQ------
TDEL0D05550        SDLDALQYSRDHYKEQKRYDFDLPR-----
Kpol_1017.9        SDDDVTTQKLSSPIQDLTYNFTI-------
TPHA0D03260        CDDDVSKAGIEKPINELNFEYNIL------
ZYRO0D10098g       SDEQVSQRSPDHPAEQLKFQFDLN------
KNAG0B00840        SDLDRDFNSPHNPKEVKQFTFDLSD-----
KLLA0E04687g       SDEDCETYSFMDPKEVIQFQFNMES-----
KLTH0F14718g       SDFEVPLHSEKHPKEKLQFNLHVDES----
Kwal_55.21217      SDPETTHFCAANPKKCVSYKINPDLQTVTS
SAKL0F02882g       CDEDVLKYGPKNPKEQIEFEFDI-------
CAGL0I10582g       SDQDISLYSTSNPKEELRYEYDIE------
KAFR0C01930        SDEEIYKYSGLNPKEVQRLDFTIT------
Skud_7.438         SDEDVNHYSVATPKEEKRFEFKL-------
Suva_7.415         SDEDVSHYSASAPKEEKRFEFEL-------
Smik_6.223         SDEDVRQYSVSAPKEEKRFEFEL-------
YGR127W            SDEDVRKYSVTSPKEEKRFKFKL-------
NCAS0E00840        SDNDIQHYSSTNPKEVKSFEFKPNIQKN--
NDAI0G00970        SDSDIKTFSPANPKETVRFDFTLNR-----
                    : :                          

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0D02990
----------------MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNST--ILY
PYDMSKDICHDGGGDERFKSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNN-SLQSR
GLIPIKYLCDF--DHG-FQDWNTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMG
QSQRVLDEENP-----YMVVSNINWGDPKKMGE--------------------WSKIKNG
IKLLETLINDKLDNS--NKDELEILEDCFQISSTINL----SGKKIDGNIERLEQTKDLI
FVPPLKR--SEGEVRGDAGGDAGGDAGGESVKYYGTRSQIVVLCERKSNKVTFVERILHC
KNEDAKDNTKKIQ-----------------
>AFR305W
----------------MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDS--ILA
PYDMALQDA--DGLDH--GSPCGTWIGINRAGHVSVLLNLAPKDADGDHGYS---HRHSR
GAVTMEYLKDF--DHNNWDSWNTYEKFGAHFPTLY-KTKLFTHFYGDVVNSQFSVINSLG
QTLDPF-SQSP-----YYVVSNGPSDGAKALGQ--------------------WPKVVEG
NQLFKKMIQ---ESL--DVSEEELLQRCFNLASYSQY-----VSNQPIGVHDDSIPKRTI
FVPALYN--LSGQA--NLSFAAG--------MYYGTRSTIVMLVSEDGNVVT-REHVIHD
SDQDLDSYSILNPKEQVTHRFSLQMH----
>Ecym_1242
----------------MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGV--ILA
PYDISNSENASDASKA--ELSYGTWLGINRVGHVSVLLNLKEVSEAVNPGAG---NRKSR
GNVTVAFLRDL--SNGNWDKWNNYEKFSEHFAALD-DTQSFTLFYGDIKTGDFGLIDSYK
RSMNPFSSKQP-----YVVISNSRVNCEDEGPR--------------------WKKVVEG
EQLLKELVK---GNL--NVSKEHLLQKCFELAGTSQF-----DVNGVIQVTDTSLPEKTI
FVPTLK---AAGNSSMGVSKIVG--------EYYGTRTTIVILVD-NFNHVTMHEHVIHD
SDKDIGLSSAMNPKTKVAYEFDIQ------
>TDEL0D05550
----------------MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNF--MLC
PLDKGLDSS---------GEDLGTWIGANRDGKIGTVLNLKLFSDPRGRPAV---CPESR
GKIPVSFLSSR--GAN-FKDWDTYDKFCHQFQGLE-FTRDFNFFYGDCSIGDYRVIDSLG
NTTKVLGKTNE----KYIVVSNDIFQGESNKNRV-------------------WDKISLA
DQALHHLVR---EFN--DTDEDKFIQECFGIASINPFHS--KHDHGNYYMKAVELSMQTV
FVPPLKT--SCDDG-LGASVPIG--------EYYGTRSQTVILVSKDRSHITYVERIIHD
SDLDALQYSRDHYKEQKRYDFDLPR-----
>Kpol_1017.9
----------------MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILC
PYDMSKSNE-KN------VNKIGTWCGINEFGRVSTILNLKNDDSFQSSVPS---TKKSR
GALPIKFLDNK--ETDSLLNWDSYEKFVKEYPFVK-ETGDFNFFYGDVRIGKYNVIDSIG
STNEVLTVDNP-----YLVISNDKFGKSNGKSTKE------------------WEKITLA
KNLLKHLP------L--CETEDDLIHKCFDIASTNTL-----NEDLIKDVDVRELMTETI
LVPPLNVMTKEEKEKIGASLPIG--------QYYGTRSQIVILVNKNRTKVKFIERILYN
SDDDVTTQKLSSPIQDLTYNFTI-------
>TPHA0D03260
----------------MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLC
PYDLSRNET--D------PSKFGTWCGINEFGRVSSVLNLKMDENKVEDKNV---RKKSR
GYLPVKFLDNR--KENSFNDWNSYSKFLKQYPDLE-KTGSFNLFIGDVKKQEYALIDSFG
QTKRILDGKDE-NGKSSVVISNSEFISNDKER---------------------WHKISNG
EKLMDEFLS---KDI--R-DENSVIESCFKIASTSEL----TNEYLHSHDDILDLMTETV
FVPPIKLENPVEKDNIGASLPVG--------KFYGTRSQIVILVNKERTTVRYMERVLYE
CDDDVSKAGIEKPINELNFEYNIL------
>ZYRO0D10098g
---------------------------------------MLARR-----W--------IY
PLPLRCTPE-HR------AHKFGTWCGINKDGRVGTVLNLKLDQGAQRGHPL---HLSSR
GKVPTAFLSQH--DLD-WEQWNSYNKFANQFSELD-NTGDFNFFYGDCKNGQYKIIDSLR
QTHDVLTNNESQDDSSYMVVSNDVYRYQGEET---------------------WPKVQLA
KKNLRKLIE---DNV--NEDQDSFISKCFQVASTSPG----LDWQSEELLKSSDVTKQSI
FVPPLKF--PPDLN-LGTTTHAG---------FYGTRSQIVLLVSKDRQKVTFVERVLHN
SDEQVSQRSPDHPAEQLKFQFDLN------
>KNAG0B00840
----------------MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDY--ILS
PYDMTKGLYDPG------KCVRGTWMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSR
GLIPFMFLSDR----GFIDQWDSFEKFRDRYPDLE-KSGDFNLFIGDIRQQDYKVLDSSG
NTFSVLNETTG----MNMVVSNDTYKEFNENDISE------------------WNKVKLG
KLKLHELVN---TAV--NLDKSSFIDKCFHAASFCSI-----EKSHEDISKTPEVISNTI
FVPPLKC--QPQQD-VGLTKSGG--------LYFGTRSQLVTLVSKDRRQVTVAERILHT
SDLDRDFNSPHNPKEVKQFTFDLSD-----
>KLLA0E04687g
----------------MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGF--ILS
PYDMAIEKK---------GQGYGTWLGINRRGRIAVILNLKIDSPLDSESVLVNGEPRSR
GIVPLQFLQQE--DNAPFDNWDSWEKFNGQHGNLR-RTGPFTLFYGDAKSDEYNVIDYLK
HSTNPFEKME------HMVISNDIFHCAVGEHTSR------------------WNKTEYG
YVLLDALAK---NTT--GIAKEELLQKCFELLSNHTF---------NEGEDVDSVTTSSI
YVPPLRI--TKGADAIGTSLPIG--------DYYGTRSQIVILVDKD-NRVTYEEHVIYE
SDEDCETYSFMDPKEVIQFQFNMES-----
>KLTH0F14718g
----------------MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDY--ILS
PLDTALRSN--N------KPALGTWCGVNRKGRVAVILNLRNKEPAKRIPVK---SPISR
GSVPMKYLMDR--GPS--TDWNSFEKFVSKYPQIT-EC-EFNMFYGDCIAGEYTCIDSLG
YSSEALTANKP-----NLVLSNDHIDSSSR-----------------------WPKVQKA
DILLQELVQ---SSQ--HDSEEELIEKCFALASN-------TEPAEIDNSDKEEFTCSSI
FIPPVEI--PEKVD-VGASLPCG--------RFYGTRSQIVILVKRHERTISFTERVLHD
SDFEVPLHSEKHPKEKLQFNLHVDES----
>Kwal_55.21217
----------------MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDY--VVS
PLDMTLKDN--N------EPNLGTWCGANRNGRIAVILNLRTGNTNQTKTK----RIVSR
GNVTMRYLTDK--QPA--SDWNSYAKFASKCPDIK-SC-EFNMFYGDCKSGDYTAIDSSG
HSFEVLRSQNP-----YLVISNDSIESATK-----------------------WPKIELA
EKLMRDLVR---DSV--NDSEDDLLARCFSLASH-------KQDYNVDHMDKEKVTSSNI
FVPPLEV--PKSED-LGASVPCG--------RFYGTRSQIVVLVSKEDKSIRFVEHVLYD
SDPETTHFCAANPKKCVSYKINPDLQTVTS
>SAKL0F02882g
----------------MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDF--IVS
PFDMSITTK---------GRNFGTWCGVNKDGKVAVILNLRIASCGNPKNVE---CPQSR
GIVPMKFLAGK--DVD-FNNWDSYEKFSHHYPGIE-KTGNFNLFYGDCSKGEYKLISSLS
ETTDGFQNDDG-----YMVVSNDLISSKKK-----------------------WGKISLA
KNLLRNLVE---SSV--DDTKDSILDKCFKLASHSTC-------SEKIVVKHESVTNETI
YVPPLLV--ENGQD-LDVSMPCG--------KYYGTRSQIVILVSKDQKKMTFVERVLYT
CDEDVLKYGPKNPKEQIEFEFDI-------
>CAGL0I10582g
----------------MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDF--ILS
PYDLARIGAGQS------NDTFGTWTGVNRKGRVATVLNLRICDELDMKRMI---GERSR
GALPFVFLNDR--QGN-FEDWDTYAKFCKCYPDIK-RTGDFNLFYGDFKEGRYALIDSLG
NTHPLFSKPGK----GYLVISNNIHDKLHLQSQDIN------------SGPEEWGKIKKG
KQIMEEFVK---TNT--NLGKEDVIENCFKLASTNLILD--KITEEFDLVKSLGVTKETI
YVQPLLT--PPHEE-IGSPLTAG--------QYYGTRSQIVLLVDKSKTKATFIERIIYS
SDQDISLYSTSNPKEELRYEYDIE------
>KAFR0C01930
----------------MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNF--ILS
PYDMSREEN-HG------NKIFGTWLGMNKKGKIATILNLRRFSSIDLKELV---KPRSR
GLIPFTFLYSDWTNEDSFEEWETFEKFKSKYPFLQ-SSGDFNFFYGDIKEGNYRIIDSLG
NTFKVLDNNNR-----NMIISNDLYQHKDEYEGKP-----------------TWGKIKIG
AERLNKFLK---ETE--RSNEDEVLAKCFELASYCSI----DSSITREENPNKELAAETI
YVPPLKV--CPDED-IGLTKTNG--------KYYGTRTQIVVLVHKDRKHVTLVEHTIHN
SDEEIYKYSGLNPKEVQRLDFTIT------
>Skud_7.438
----------------MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDF--ILS
PYDLAKTSK--E------KQIFGTWSGINREGKLATILNLKLDGQ---RDTI---KSKSR
GLLPFTFLSTH--KAD-FQNWDNYDKFEMNYDGLN-TTGDFNFFYGDVIEKQYKLIDSLG
RTFNVLDSTCKSNLNSYMAVSNGEFYNSPSISEQA------------------WKKVKVA
RDGLEKLVL---GNI--DSDEETIISNCFQLASKSSVPGTASKPNALQMLADPNVIMNTI
YVPPLRR--PPDDD-LGASIPDG--------DYYGTRSQIVLLVSKNSSKVTFIERILYS
SDEDVNHYSVATPKEEKRFEFKL-------
>Suva_7.415
----------------MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDF--ILS
PYDVAKTSM--E------KQIFGTWSGINKEGKLATILNLKMDDQ---RSCT---KSKSR
GMLPFTFLTSH--KAR-FQDWDDYNKFEKHYDGLR-TTGDFNFFYGDVIEKRYKVIDSLG
HTFDVLGSTCRRDPDSYMVISNGKYHNSSSISEQA------------------WEKVKIA
RDSLETLIL---DNI--ESDEETLISNCFQLASKSSLPDTGLKPDLLQMLVDPNVTMNTI
YVPPLRR--PPGDD-LGASIPDG--------DYYGTRSQIVLLVSKDSSKVTFIERVLYS
SDEDVSHYSASAPKEEKRFEFEL-------
>Smik_6.223
----------------MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDF--ILS
PYDLARTSK--E------GQEFGTWSGINKEGKLATILNLKLGSE---RSTI---KSKSR
GLLPYIFLSNH--EAN-FKDWDSYSKFGNHYDGLK-ATGDFNFFYGDVIEKQYKVIDSLG
RTFDVLSSTCRKDLDSYMVISNGRFYNTSSIPEKA------------------WEKVKLA
RDSLEDLVS---DNI--GLDEETIISSCFQLASKSSLPGTVSKPDVLQMLVDPNVTMSTI
YVPPLRR--PPGDD-LGASIPDG--------DFYGTRSQIVLLISKDSTKATFIERIIYS
SDEDVRQYSVSAPKEEKRFEFEL-------
>YGR127W
----------------MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDF--ILS
PYDLAKTSA--E------KQIFGTWSGINKEGKLATILNLKLDNE---QNNT---KSRSR
GLLPFIFLSIH--KAD-FEDWDNYKKFEGHYDGLK-STGDFNFFYGDVIKKQYKVIDSLG
RTFDVLSSTCRKDLDSYMVVSNGKFYDSSSIPGQA------------------WEKVKVA
RDSLENLVL---ENI--ESDEEKIISSCFQLASKSSLPSTISNPDVLQMVD-PNVTMNTI
YVPPLRR--PPRDD-LGASIPDG--------DYYGTRSQIVLLVSKDSTRVTFIERVLYS
SDEDVRKYSVTSPKEEKRFKFKL-------
>NCAS0E00840
MGNSSPQIKLINKQQTMCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDF--ILS
PFDMAKSCELHE------KKIFGTWIGINRDAKIATILNLKLESQLDLKQLV---KPQSR
GMIPFVFLSEH--DSD-FNKWDTYEKFDGKYNYLR-KTGDFNFFYGDPLNDEYRIIDSKG
NTFKVLSGD-P-----YLTVSNDMFATGGITVERASN-----------NRIAEWRKIKFG
KILLQDLVE---ESK--SLDEDMLIEKCFKLASTCSV----QPKENTKFNQNSTLPMETI
FVPPLEC--EVNDD-IGTSLSVG--------KYYGTRSQIVILISKNHERVKLVEHILYT
SDNDIQHYSSTNPKEVKSFEFKPNIQKN--
>NDAI0G00970
----------------MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDF--ILS
PYDMAKECKYND------KKVFGTWLGINKDGKIATVLNLKLNKSLSLKQLV---APKSR
GMLPFVYLSDM--TEDSFAEWDGYDNFTKKYPGLQ-STGDFNLFYGDVKRKQYRIMDSIG
NTVSTLNSNCQ-----YLVVSNDVFTCNGQLGELQSNIKREGKQPCLQSKIETWGKVKLG
TALLQSLVN---KSIVEKQDEDTIISECFKLSSTCSV----TVEDHCKFHQNSTLPNETI
LVPPLRC--KITDD-VGTSLPIG--------EYYGTRSQIVILIKRGTYEVKFAEHVIYT
SDSDIKTFSPANPKETVRFDFTLNR-----