MUSCLE (3.8) multiple sequence alignment

KLLA0E04709g       MVISKERSIPTITKTKHSHHSMSSL-----------------------------------
KAFR0C01920        ------------MSIEQDVEDISSFSSIESYKPEPFVGQGIARENTDELEFQSNLKDAQS
SAKL0F02904g       --MQEE---LEGKTTGGTDMELSSLSSTESFEPQAFTGA---------------------
KLTH0F14696g       --MCSN---RNDGDEASSELELSSLSSSDSFEPRAFEG----------------------
Kwal_55.21215      ------------------------------------------------------------
TDEL0D05540        ---MAPGTTTKLDDASNQFDEVSSFSSIDSYQPQPFTGQ---------------------
KNAG0B00850        --MSN----RSDIVTDPEFDEVSSFSSVDSYKPEPFVGF---------------GTEEEQ
CAGL0I10604g       --MSYN---GTTSDTDYEVEDISSFSSVDSYKPEPFTGL---------------------
Skud_7.437         --MPVP---SVSVTTDNEYEDISSFSSIDSYKPEPFTGF----------------KDSQA
Suva_7.414         --MAVP---TVSVTTDNEYEDISSFSSIDSYKPEPFTGF----------------KDSQA
Smik_6.222         --MPVP---SVTVTTDNEYEDISSFSSIDSYKPEPFTGF----------------KDSQL
YGR126W            --MPVP---SVTVTTDNEYEDISSFSSIDSYKPEPFTGF----------------KDSEA
NCAS0E00850        --MEHR---LSTTSTEHDFEDVSSFSSIDSYQPEPFTGV-----------------KEPT
NDAI0G00980        --MTHSGNIISADNTDNEFDDISSFSSIDSYQPEPFTGL----------------KGNEL
Kpol_1017.10       -MTSKQDNNNRNSTDSSNFEDISSFDSQNSFAPQEFKGN---------------------
TPHA0D03250        MVTDNY---SKSTTDSENFDDVSSFNSDNSYTPQEFIGD---------------------
                                                                               

KLLA0E04709g       -------------------------------------VQKQSSPLSKISTTQ-EVEDYVK
KAFR0C01920        HTSEKFQEEQVDPLKQVQTNDSFWSFRSVSNT-----SRTSSKNLKKQRSRD--IERIVT
SAKL0F02904g       --DPSVEQPTIDHELEDEIDPEPLSGNPVRPNSEEILSVRSSNTLKKLDSNA--IEKVLT
KLTH0F14696g       ---PPSEIKSLEPEGSVQASPSIDSKDFH--------RVKSNGTLRKQDSNA--IEQIMT
Kwal_55.21215      ----------------------------------------------------------MT
TDEL0D05540        --------------EELPQEKNPDSSSRR--------SSKSGTTLNHQDSNT--IEKEVT
KNAG0B00850        HDSRLFKNDTILNSEDLAENTANTPSDLN--------SKASSTTLGKRDSNA--IERVVT
CAGL0I10604g       ---EHTKNENLSRKATNASQGTYMDDAT---------SKHSGATLKKLDSLA--IEKVVT
Skud_7.437         PEQPLLKNDTIVGKAQSENEENIDEQHRHSDVY----SHHSSSTLKRPSSNS--IEKMIT
Suva_7.414         PEQPLLKNDTIVGKGQSENDDSVDDQHRHSDVH----SHHSSSTLKRPTSNS--IEKMVT
Smik_6.222         PDQPLMKNDTIVGKGQSENDDILDDQHRHSDVH----SHHSSSTLKRPTSNS--IEKMVT
YGR126W            PEQPLLKNDTIVGKGQLEDDSNVDDQHRHSDVH----SHHSSSTLKRPTSNS--IEKMVT
NCAS0E00850        AYKGTDRKDTLSGDETELKQEHTNATATSSHTKDGITSRTSMSTLRRPDSNA--IERVIT
NDAI0G00980        ---PNAQPSTTATTTEQDHDDTVISSHSHDTKHGEEPSRTSTATLKKLDSNVNDIEKTMT
Kpol_1017.10       ------------LDSNNDNDTGVFNKTKS--------GTSETNTLKVNSSNE--IEKIVT
TPHA0D03250        ---TLGKESSTKMDDRASHLSHAIKETRS--------GTSDNNTIKPVTSND--VHRIVS
                                                                             :.

KLLA0E04709g       DNVQKGETDSIDSLKATNLD-LSKKAIPGFNQPIAEGAE---FPEEYEIETRTGLVKVAT
KAFR0C01920        QNAMLGKAETVDSLRATGLD-LTKRAVPDINSPIS---HESKLIDESKFETDTGLIKTKT
SAKL0F02904g       HNAVEGNTETLESLKTRGLD-LRKKAIPDYNNPAMHTDRSQ-FPEEYQIETETGLVKVKT
KLTH0F14696g       HNATEGRSETVESLKKNGLN-LQKKAIPDINNPAANYKNCA-FPEEYQMETDTGLVKAQT
Kwal_55.21215      HNATEGRSETVDSLQRNGLN-INQKAVPDYNNPAANFTNCE-FPEEYQLETDTGLVKVQT
TDEL0D05540        HNAMNGTSETAKSLQQAGLD-TEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLKT
KNAG0B00850        KNAMNNQSESADALRSKGLDTTKRRNIPDINAPLTLTQSH--FPEEYQVETETGLVKMKT
CAGL0I10604g       QNAVAGNSETIESLKAKGLD-MQRKAIPDYNAPLTTTGTNQ-FPEEYRLETDTGLVKMKT
Skud_7.437         HNALEGNSETADSLKREGLN-LNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKT
Suva_7.414         HNALEGNSETVDSLKKEGLN-LNKKGTPDITAPVTNSAHDAAFPEEYRLETETGLVKLKT
Smik_6.222         QNALEGTSETLDSLKEDGLN-LKKKALPDITAPVTNSAHDATFPEEYRLETETGLVKLKT
YGR126W            HNALEGNSETVDSLKEDGLN-LNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKLKT
NCAS0E00850        SNAKEGNTETLGSLAAKGLD-LNKKATLDINAPLTSNPADVAFPEEYNLETETGLVKAKT
NDAI0G00980        TNIMNDKTETLDSLVKQGLN-TRKKSVADINTPLNAGTAE--FPEEYRIETETGLVKAKT
Kpol_1017.10       RNALENNTETVATLRETESK-LSKVPTENV-LPATMENNAA-FPEEYRIETKTGLVPIKT
TPHA0D03250        RNIMDNNVESEEALKTQLTNMESRRA--DIILPASMEGNSN-FPEEYTMETTTGLVPVKT
                    *   .  ::  :*     .   .    .   *         : :*  .** ***:   *

KLLA0E04709g       LHQLNRLDTRVT-------------------THSSKKSTKEKNTS------------CGY
KAFR0C01920        LETLNRSNTRNS-------SSKRKILGNDNSNTS------------------------GL
SAKL0F02904g       LQSLNRLDTRVS-------LGNKPSTNQNMEAESAHDEQRP----------------VGY
KLTH0F14696g       LHGLNRLESRTSGRSG---ASQKKSIRTANSTTNSDLASANNTIN-------------GL
Kwal_55.21215      LQKLNRLESRTSIRSG---NSQRKSMRSTPSTDHSISPSAGRSSN------------SGL
TDEL0D05540        LNDLSRSDTRVSIGSDGKISRKSSGPGTIDSKIEPKPDTAKAEQE------------AAQ
KNAG0B00850        IESLKSRHSGGT-------HNSKKSKGASTRSKNSLTSSMEEHGE------------AGL
CAGL0I10604g       LETLKRKSTQVS------------RNSDLSSKDKSISKSQSNKSE------------VSD
Skud_7.437         LETLKREDSRVS-------SAKKEHTNDHADAHSTRSKVTTYSQG------------SSL
Suva_7.414         LETLKREDSRVS-------GAKKDHGHDHTDAHSTRSKATAYSQG------------SSL
Smik_6.222         LETLRREDSRVS-------STKKEHNNDHTDIHSTRSKVTTNSQG------------SSL
YGR126W            LESLKREDSRVS-------STKKEHINDHTDMHSTRSKVTTNSQG------------SSL
NCAS0E00850        IETLRRETSRVS-------STRR---GDDVVSHKSQATGKSQRSA------------QSL
NDAI0G00980        IESLRRQESIAS-------ANSRRSQDQGSFKSARTNNTRKSRAS------------SSL
Kpol_1017.10       LEEMHSNKSNGKNEENEHHNHQHNHHNHHNHHHHHEKNDEDKDVEQKEKHPAEHLPHGKL
TPHA0D03250        LEDIKKKKTIDS-------ENSRKSLVSSELKASKSNNTVKSRNE------------GGL
                   :  :    :  .                                                

KLLA0E04709g       DNDKLQKCIERNQKEIDSYHK---KSG-FKKFIGKLFG---
KAFR0C01920        DPERMNMVVERNRKKLEKYQQHKKEKG-LKGFFYKIFD---
SAKL0F02904g       DEEKLKKAVDKNKKKIEKYQKHKHEKG-IKGFMSRLFG---
KLTH0F14696g       DGEKLRRAVEKNQKKIDKYQKHKSSGG-LRRFLGKIFD---
Kwal_55.21215      DAEKLRKAVEKNKRQIDKYQKHKASGG-LKKFLGKIFD---
TDEL0D05540        NAENLEHAIEKNKHRIEKFEKHRHEKG-LKGFVHRLFD---
KNAG0B00850        NAEKLNSAVERNRKELERYEKNRGKKG-IKGFLSKMFQ---
CAGL0I10604g       IAQKINMAVERNKKEIAKYQKHKSEKG-IKGFFHRMFD---
Skud_7.437         ESDKLNMAVEKNKKKIEQYRKHKSEKG-IKGFFHRIFD---
Suva_7.414         ESDKLNIAVEKNKKRIEKYQKHKGEKG-IKGLFHRMFD---
Smik_6.222         EPNKLNMAVEKNKKKIEQYQKHKSEKG-IKGFFHRIFD---
YGR126W            EPNKLNMAVEKNKKRIEKYQKHKSEKG-IKGFFHRIFD---
NCAS0E00850        QAEKLNLAVEKNKKELEKIEKHKHQKG-LKGFMNRLFD---
NDAI0G00980        DPNKLNMAVEKNKKELEKYSKHKQQKG-IKGFFNRLFD---
Kpol_1017.10       EQKNIDIVVERNKKQLEKWEEHKHEINPVKKFIYKFLDSYQ
TPHA0D03250        NPAKLNAAVEKNKEELEKYQHHKTEKNPIKKMLFKLFY---
                      .:   ::.*.  :        . . .. :. .::    

FASTA FORMAT for MUSCLE Version 3.6

>KLLA0E04709g
MVISKERSIPTITKTKHSHHSMSSL-----------------------------------
-------------------------------------VQKQSSPLSKISTTQ-EVEDYVK
DNVQKGETDSIDSLKATNLD-LSKKAIPGFNQPIAEGAE---FPEEYEIETRTGLVKVAT
LHQLNRLDTRVT-------------------THSSKKSTKEKNTS------------CGY
DNDKLQKCIERNQKEIDSYHK---KSG-FKKFIGKLFG---
>KAFR0C01920
------------MSIEQDVEDISSFSSIESYKPEPFVGQGIARENTDELEFQSNLKDAQS
HTSEKFQEEQVDPLKQVQTNDSFWSFRSVSNT-----SRTSSKNLKKQRSRD--IERIVT
QNAMLGKAETVDSLRATGLD-LTKRAVPDINSPIS---HESKLIDESKFETDTGLIKTKT
LETLNRSNTRNS-------SSKRKILGNDNSNTS------------------------GL
DPERMNMVVERNRKKLEKYQQHKKEKG-LKGFFYKIFD---
>SAKL0F02904g
--MQEE---LEGKTTGGTDMELSSLSSTESFEPQAFTGA---------------------
--DPSVEQPTIDHELEDEIDPEPLSGNPVRPNSEEILSVRSSNTLKKLDSNA--IEKVLT
HNAVEGNTETLESLKTRGLD-LRKKAIPDYNNPAMHTDRSQ-FPEEYQIETETGLVKVKT
LQSLNRLDTRVS-------LGNKPSTNQNMEAESAHDEQRP----------------VGY
DEEKLKKAVDKNKKKIEKYQKHKHEKG-IKGFMSRLFG---
>KLTH0F14696g
--MCSN---RNDGDEASSELELSSLSSSDSFEPRAFEG----------------------
---PPSEIKSLEPEGSVQASPSIDSKDFH--------RVKSNGTLRKQDSNA--IEQIMT
HNATEGRSETVESLKKNGLN-LQKKAIPDINNPAANYKNCA-FPEEYQMETDTGLVKAQT
LHGLNRLESRTSGRSG---ASQKKSIRTANSTTNSDLASANNTIN-------------GL
DGEKLRRAVEKNQKKIDKYQKHKSSGG-LRRFLGKIFD---
>Kwal_55.21215
------------------------------------------------------------
----------------------------------------------------------MT
HNATEGRSETVDSLQRNGLN-INQKAVPDYNNPAANFTNCE-FPEEYQLETDTGLVKVQT
LQKLNRLESRTSIRSG---NSQRKSMRSTPSTDHSISPSAGRSSN------------SGL
DAEKLRKAVEKNKRQIDKYQKHKASGG-LKKFLGKIFD---
>TDEL0D05540
---MAPGTTTKLDDASNQFDEVSSFSSIDSYQPQPFTGQ---------------------
--------------EELPQEKNPDSSSRR--------SSKSGTTLNHQDSNT--IEKEVT
HNAMNGTSETAKSLQQAGLD-TEKKAIPDINGPITGNADTSQFPEEYRIETQTGLVKLKT
LNDLSRSDTRVSIGSDGKISRKSSGPGTIDSKIEPKPDTAKAEQE------------AAQ
NAENLEHAIEKNKHRIEKFEKHRHEKG-LKGFVHRLFD---
>KNAG0B00850
--MSN----RSDIVTDPEFDEVSSFSSVDSYKPEPFVGF---------------GTEEEQ
HDSRLFKNDTILNSEDLAENTANTPSDLN--------SKASSTTLGKRDSNA--IERVVT
KNAMNNQSESADALRSKGLDTTKRRNIPDINAPLTLTQSH--FPEEYQVETETGLVKMKT
IESLKSRHSGGT-------HNSKKSKGASTRSKNSLTSSMEEHGE------------AGL
NAEKLNSAVERNRKELERYEKNRGKKG-IKGFLSKMFQ---
>CAGL0I10604g
--MSYN---GTTSDTDYEVEDISSFSSVDSYKPEPFTGL---------------------
---EHTKNENLSRKATNASQGTYMDDAT---------SKHSGATLKKLDSLA--IEKVVT
QNAVAGNSETIESLKAKGLD-MQRKAIPDYNAPLTTTGTNQ-FPEEYRLETDTGLVKMKT
LETLKRKSTQVS------------RNSDLSSKDKSISKSQSNKSE------------VSD
IAQKINMAVERNKKEIAKYQKHKSEKG-IKGFFHRMFD---
>Skud_7.437
--MPVP---SVSVTTDNEYEDISSFSSIDSYKPEPFTGF----------------KDSQA
PEQPLLKNDTIVGKAQSENEENIDEQHRHSDVY----SHHSSSTLKRPSSNS--IEKMIT
HNALEGNSETADSLKREGLN-LNKKALPDITAPVTNSAHNGAFPEEYRLETETGLVKLKT
LETLKREDSRVS-------SAKKEHTNDHADAHSTRSKVTTYSQG------------SSL
ESDKLNMAVEKNKKKIEQYRKHKSEKG-IKGFFHRIFD---
>Suva_7.414
--MAVP---TVSVTTDNEYEDISSFSSIDSYKPEPFTGF----------------KDSQA
PEQPLLKNDTIVGKGQSENDDSVDDQHRHSDVH----SHHSSSTLKRPTSNS--IEKMVT
HNALEGNSETVDSLKKEGLN-LNKKGTPDITAPVTNSAHDAAFPEEYRLETETGLVKLKT
LETLKREDSRVS-------GAKKDHGHDHTDAHSTRSKATAYSQG------------SSL
ESDKLNIAVEKNKKRIEKYQKHKGEKG-IKGLFHRMFD---
>Smik_6.222
--MPVP---SVTVTTDNEYEDISSFSSIDSYKPEPFTGF----------------KDSQL
PDQPLMKNDTIVGKGQSENDDILDDQHRHSDVH----SHHSSSTLKRPTSNS--IEKMVT
QNALEGTSETLDSLKEDGLN-LKKKALPDITAPVTNSAHDATFPEEYRLETETGLVKLKT
LETLRREDSRVS-------STKKEHNNDHTDIHSTRSKVTTNSQG------------SSL
EPNKLNMAVEKNKKKIEQYQKHKSEKG-IKGFFHRIFD---
>YGR126W
--MPVP---SVTVTTDNEYEDISSFSSIDSYKPEPFTGF----------------KDSEA
PEQPLLKNDTIVGKGQLEDDSNVDDQHRHSDVH----SHHSSSTLKRPTSNS--IEKMVT
HNALEGNSETVDSLKEDGLN-LNKKALPDITAPVTNSAHDAAFPEEYRLETETGLVKLKT
LESLKREDSRVS-------STKKEHINDHTDMHSTRSKVTTNSQG------------SSL
EPNKLNMAVEKNKKRIEKYQKHKSEKG-IKGFFHRIFD---
>NCAS0E00850
--MEHR---LSTTSTEHDFEDVSSFSSIDSYQPEPFTGV-----------------KEPT
AYKGTDRKDTLSGDETELKQEHTNATATSSHTKDGITSRTSMSTLRRPDSNA--IERVIT
SNAKEGNTETLGSLAAKGLD-LNKKATLDINAPLTSNPADVAFPEEYNLETETGLVKAKT
IETLRRETSRVS-------STRR---GDDVVSHKSQATGKSQRSA------------QSL
QAEKLNLAVEKNKKELEKIEKHKHQKG-LKGFMNRLFD---
>NDAI0G00980
--MTHSGNIISADNTDNEFDDISSFSSIDSYQPEPFTGL----------------KGNEL
---PNAQPSTTATTTEQDHDDTVISSHSHDTKHGEEPSRTSTATLKKLDSNVNDIEKTMT
TNIMNDKTETLDSLVKQGLN-TRKKSVADINTPLNAGTAE--FPEEYRIETETGLVKAKT
IESLRRQESIAS-------ANSRRSQDQGSFKSARTNNTRKSRAS------------SSL
DPNKLNMAVEKNKKELEKYSKHKQQKG-IKGFFNRLFD---
>Kpol_1017.10
-MTSKQDNNNRNSTDSSNFEDISSFDSQNSFAPQEFKGN---------------------
------------LDSNNDNDTGVFNKTKS--------GTSETNTLKVNSSNE--IEKIVT
RNALENNTETVATLRETESK-LSKVPTENV-LPATMENNAA-FPEEYRIETKTGLVPIKT
LEEMHSNKSNGKNEENEHHNHQHNHHNHHNHHHHHEKNDEDKDVEQKEKHPAEHLPHGKL
EQKNIDIVVERNKKQLEKWEEHKHEINPVKKFIYKFLDSYQ
>TPHA0D03250
MVTDNY---SKSTTDSENFDDVSSFNSDNSYTPQEFIGD---------------------
---TLGKESSTKMDDRASHLSHAIKETRS--------GTSDNNTIKPVTSND--VHRIVS
RNIMDNNVESEEALKTQLTNMESRRA--DIILPASMEGNSN-FPEEYTMETTTGLVPVKT
LEDIKKKKTIDS-------ENSRKSLVSSELKASKSNNTVKSRNE------------GGL
NPAKLNAAVEKNKEELEKYQHHKTEKNPIKKMLFKLFY---