MUSCLE (3.8) multiple sequence alignment

AFR304W            -----MTKNRRFSAWSHRPSISEALNIQLNIPDS-----PSGGANAGGPVSERIPTL---
KLLA0E04731g       ----------MSTAQNSSVSMSQSQSTAKNRKYS--------------------------
TBLA0C04440        --MVYAQQDSDNNSNRERNKLSEAISISLGLQEQ----QGNDNDKYNNDNSNIHGTLNNS
TPHA0D04210        -------MPSRKKERRVSSSFSEALSVSLGLQEQGNLRSTERANVKRNAIFDEFPLEST-
Kpol_480.18        MNNNQNYSGQDSSNRRVRPSFSEALSVSLGLHEQGIGAGRTRSNLAPNSYSGYNDNTTS-
SAKL0F02926g       -----------MPNKKNRKSISEAITISLGLHSD---NIKQPSQANRRSSMNPE------
KLTH0F14674g       ---------MGFSRPRNKHSLSEAISVSLGLQSQ----PGSETDTLSVPRGNPFSNGAD-
Kwal_55.21201      ---------MVSNRPKNKPSISEAISVSLGLQSQ----SNSDQDSSYIPRANPFSHTGD-
CAGL0I10626g       ------MKSPQQRRKNSILSISESISVSLGLQYP-----EGNRDGSIDRLNESNSLNVNA
KNAG0B00860        ----MGMSKAHRIKRPARQSISESISVSLGLQNN---------DARQSDNENPLQVL---
TDEL0D05530        ---MPSTGNTGGPRNRGRHSISEAISVSLGLQNT-----NTPRDHHDGNHSNPYDSQND-
KAFR0C01910        ---MTSFNKSNDARASKRLSLSDSISRSLGLQDQ----ESNIAGTDNELS----------
ZYRO0C07986g       ------MSNGVDRPSRNRQSISGAISVSLGLNRQVHRNSDGEFTNYNNTNNNGGRINQND
Suva_7.413         -------MGRNIRRRRSNSSLSEAITVSLGINYQ----DSSKNKIHRASA----------
Skud_7.436         -------MGRTIRRRRSNSSLSEAISVSLGINQD-----SSKNKMHRASV----------
Smik_6.221         -------MGRTIRRRRSNSSLSEAISVSLGINQD-----SSINKMHRASV----------
YGR125W            -------MGRTIRRRRSNSSLSEAISVSLGINQD-----SSVNKMHRASV----------
NDAI0G00990        ----------MRRQKNNRHSISDTISVSLGLQNQ-------DPQILQQPNGGPTVTLGN-
NCAS0E00950        ---MSHRNSIDFKKKNKQQSISGSISVSLGLQQE-----EEPRDDYFDDEN---------
                                      .:* : .   .                              

AFR304W            -----------MRPEAYLG-RSYV-GSFSNSG------SLMSREAG-----------AA-
KLLA0E04731g       --------FQMPTTSTYLG-RSYV-GSFISPPMEYRSNSNTTSNNN-----------NNS
TBLA0C04440        RQRRKPSISLDPTLSRNIGARSFNCGAFLSRSIDNNLPTTDMFNSSTFRSSNSNNYFTHG
TPHA0D04210        -----------NSLTLPDS-MSMK-NNTVNIN------DKLVPDNS-----------KNR
Kpol_480.18        --------SVSNREFGRIG-RSYA-GSISSNS------PSLYLNTS--------------
SAKL0F02926g       -----------NSSNYYLG-RSYV-GSFSSPS------FLQRESSA--------------
KLTH0F14674g       -----------GSPHYYLG-RSYV--ANLSPP------PLAIKERF--------------
Kwal_55.21201      -----------GSPHYYLG-RSYV--ANLSPP------PLARLPGG--------------
CAGL0I10626g       RPNTKNVGIPNNDTNTFLG-RSYV-SGILGSS---------LPQGG--------------
KNAG0B00860        -----------PGESSYLG-RSYV-SGLWSPT--------QRNNKS--------------
TDEL0D05530        --------QFMSPRNNYLG-RSYV-SGFLSCS--------PYGSNS-----------L--
KAFR0C01910        -----------NSKSNYLS-RSYM-YGLL---------PSATPVEE-----------L--
ZYRO0C07986g       SSSIEIVSPPFYNSNNYAG-RSYLGGGFLSAS------PKMNLQQR-----------ND-
Suva_7.413         -----------STMSPPLC-RSYM-SGFFTGG------SSPMNYNM--------------
Skud_7.436         -----------SAMSPPLC-RSYM-SGFFTGG------SSPMVKNM--------------
Smik_6.221         -----------SAMSPPLC-RSYM-SGFFTGG------NSPMINSM--------------
YGR125W            -----------SAMSPPLC-RSYM-SGFFTGG------NSPMINNL--------------
NDAI0G00990        ----------MSDTSNYLG-RSYV-SGFLSAS------PAINHDN---------------
NCAS0E00950        -----------VNNNNYMG-RSYV-SGFLSVS------PALMGSMK--------------
                                        *                                      

AFR304W            ---GPDSPPLPRF--RDQASSYVHNGSHLHRQTAALCDDSRAYDGGPEEEE--------A
KLLA0E04731g       NVGDPFKSPF-----SSEGSKLIHESGNLHKQTAFLSNTFDNDAGNDEGAG--------F
TBLA0C04440        LNSNNDHLPVI----NPFPKSSIHGSDNLHKRTAEISNEFNNSPTDTEDDNANTETPNIP
TPHA0D04210        TFYNDSIYPPE----NKTSMKSITVADILHRQTAELSKTFYDSNFTD------------K
Kpol_480.18        --RTDELLPI-----RKMPSKSILGPDALHRQTAEISNDFNDTSM----DE--------A
SAKL0F02926g       ---DTGHILSL----HKDASKSIHESVKLHRQTAALSNNFDDSSDGKSDE---------I
KLTH0F14674g       ---SGDPTSSS----RPEQSQSIHQSLSLRRQTAALSNEFDGT-----------------
Kwal_55.21201      ---LPGELPLSY---RPEQSQSIHQSVSLRRQTAALSNEFEDT-----------------
CAGL0I10626g       ---ERNTLPVS----NKFGSRAIHEQNKLHRQTAAIAEEFDDGTIGE--SP--------S
KNAG0B00860        ---GYDLLPTSN---EQAYSKPIHKSQMLHRQTQAIGENFSDSNGDEGSEN--------K
TDEL0D05530        ---ESDRLPI-----ARMRTKSIHAAKNLHRQTAKLCEDFNEPNV----ED--------N
KAFR0C01910        ---ETNTLPLS----NDLRNKSIHQSRILHKQTAAICEDFNES------DE--------G
ZYRO0C07986g       ---DSSVLPI-----DRSRSKSIHGSQIIHRQTAELSNNFSDDTTGM------------E
Suva_7.413         ---SDPKLPFS----NKQHPKVIHGSENLHRQTAQLSNEFCSSSVEE--NS--------P
Skud_7.436         ---SDSKLPFS----NKQHPTVIHGSENLHRQTAQLSNEFCSSSVEE--NS--------P
Smik_6.221         ---SDSKLPLS----NKQHPKVIHGSENLHRQTAQLSNEFCSSSVEE--NS--------P
YGR125W            ---SDSKLPIS----NKQHPKVIHGSENLHRQTAQLSNEFCSSSVEE--NS--------P
NDAI0G00990        ---NNNTLPIA----NQHLNKSIHASQNLHRQTAAISEDFNNDPTFE--DD--------I
NCAS0E00950        --QDEESLPMAYNGGQRLFNRPIHASEKLHKQTAAISEDFEDDE-----DD--------T
                                         :     :...*  : .                      

AFR304W            LV----------FEGNMILQEGAPP--------------------------------RFG
KLLA0E04731g       PLDGNDDEFNLEQNDIDMIVEEDQMLQNSQRRRGRM-------------------SVDAA
TBLA0C04440        STAQSSNNLNDSNDFMIELDGNNNTNNSNNIVSSELPPTATSMFNNTNSTATSVQSLKIG
TPHA0D04210        DV----------KDYIDIIDNDVAT---------------------------------SN
Kpol_480.18        KI----------KRYIELLNRKQIE-----AEEEG------------------------E
SAKL0F02926g       DVAAS-------QEFQNEALQRELS---------------------------------LE
KLTH0F14674g       ------------FEFEDQLEDLAEN-----------------------------------
Kwal_55.21201      ------------FEFEDQLAGVSED-----------------------------------
CAGL0I10626g       SL----------KEYLNLLDEAQEE----------------------------------E
KNAG0B00860        DL----------NEYIDLVEHNERK--TANIDNVD------------------------Q
TDEL0D05530        NI----------QDYVSATEEPRPM-----------------------------------
KAFR0C01910        SM----------KDYLDFIENTDRD-----------------------------------
ZYRO0C07986g       EV----------RNRYDAMEDENSS-----------------------------------
Suva_7.413         TI----------KDYMDIIDSDDRK-----------------------------------
Skud_7.436         TI----------KDYMDIIDSDDRK-----------------------------------
Smik_6.221         TI----------KDYMDIIDSGDRK-----------------------------------
YGR125W            TI----------KDYMDIIGNGDRK-----------------------------------
NDAI0G00990        NM----------KEYISNLEDDATG----------------------------------N
NCAS0E00950        RI----------KDYITLFQGEDNG------------------------------LMADK
                                                                               

AFR304W            VGPYNLCKVDSNISEVLLNVDEAV--DDSDSDQEAGTRLFLSPI-----------TTDYI
KLLA0E04731g       ADIEADAHLMDLEDMALKRADDVGIFSTSFPGKDDSSFLDVSDSTENLALLPTNSHNSMY
TBLA0C04440        NNEILKTISGDNGGIVNRLPIQEL--DEDIIDNDEYSRLLPTPS-------PSIYDDENA
TPHA0D04210        ESDSNSTPEPYLGDEYDQHRLAIRTQKSPNIADDEQSRLLTPSS----------------
Kpol_480.18        ESAVHLRPHTFIEGKSFLSPIGSS--ASQLDGLEQ--RALLTPS----------------
SAKL0F02926g       NGSYSNSNNNNNNNNQIAYSEDAI--TQENNGLNECTRLLSPTS-----------AAATD
KLTH0F14674g       -GNTAVPDESVMAGSAISPTSSGP--EPSVLDNTDVSNLLLPPN------------TQRD
Kwal_55.21201      DGHSTTAEEPSMNGTLISPVSSVP---DTPIDINEPSNALLPPN------------AEHD
CAGL0I10626g       LDLRNRRDLDNDLITDNKTPVSINLKRATDPELEQQTVALLTPS---------SSNNDNY
KNAG0B00860        IGGLATGPQTTVPGNKTHPVTSPL--SDEYGIPDENSRLLLTPV-SSLSVAISDASSLTP
TDEL0D05530        -EISDAERMYDQEDELRNPVHVNT--EDRGDDIEDVYESLVTGA----------------
KAFR0C01910        ------NINEHKESLPVTVVLSTP--ADEVEEQDESSRLLLTPS-------------SSN
ZYRO0C07986g       --------------------------LHHYMTHQDYQTLP--------------------
Suva_7.413         ------------DDQSMRTIEENI--DEEYA--DEYSRLLLSPA----------SSNVDD
Skud_7.436         ------------DDQSMRTIVENI--DEEYS--DEYSRLLLSPA----------SSNVDD
Smik_6.221         ------------DDQSMRTIEEDI--DEEYS--DEYSRLLLSPA----------SSNIND
YGR125W            ------------DDQSMRTIEENI--DEEYS--DEYSRLLLSPA----------SSNVDD
NDAI0G00990        NGKRYTAYYIDNEDRIDNILTEEAEPVTDFYPQDENSRLLLSPI-------PSDSLLAGE
NCAS0E00950        NDSLDQRLGLGQDEEAEEDFIEPV---AEAADVDESSRLLISPL-------SSNINPNID
                                                                               

AFR304W            HSYGAINEE---------QSASETA---SRAETGPSPLR---------------------
KLLA0E04731g       VEYGTFDEENQP------ATQYISLLPDGASSGGFTSQGFRSS---------------MS
TBLA0C04440        LFFSSSNNYDSTDLE---NNNYISS---SIPTTTDVTQS--TS---------------LS
TPHA0D04210        -SIIGAELDL--------EAHYDEF---EPVRMDASSIN-------------------RQ
Kpol_480.18        SSIVGNEFDL--------ESTYDEI---NNDYNSILRIQ--SR---------------EL
SAKL0F02926g       LEYGTSPTNLSPPSSQYEQEQYVSLVADHSPSSAVYDQATGDGDNAFNTYHSLRQPVVRS
KLTH0F14674g       LEYGSIDEF---------DHQYVSL---QSQRAGSNSRAIDPN---------------AS
Kwal_55.21201      LEYGSIDGY---------EHQYVSL---QSRRSGANTHNIGPD---------------AS
CAGL0I10626g       GSVSPEENFLSATSNYEQESTYQSI---TVVPSAGFRQM--PT---------------ST
KNAG0B00860        EDYNGRARSPLNGINSTYGSQIPTL---SSYSSAGMKIGP-PI---------------TS
TDEL0D05530        ------------------HGGYRAI---PTSPGGGLRTS--SR---------------SA
KAFR0C01910        AEVSSIAEGL--------RHHYSSI---ESTKDNNMPIEEQQD---------------NT
ZYRO0C07986g       ---GGTDEDW--------TNNNNSQ---TARASGSS------------------------
Suva_7.413         ERNRALQGSPTSDLEDGHGGGYQSV-----HPSHDLRFGP------------------RS
Skud_7.436         ERNRALQSGPISELEDDYGGGYQSL-----RPSHNLRFR---P---------------RN
Smik_6.221         DRNRGLQNGLTSELEDDYEGGYQSL-----RSSHNLRSR---P---------------RN
YGR125W            DRNRGLQNSSLPELEDGYAGGYQSL-----RPSHNLRFR---P---------------RN
NDAI0G00990        NLLPSISEQEQETAQRRRTSAYQSI---RHRNSESTEYS---S---------------IP
NCAS0E00950        DLLPTVTGED--------VSSYQSI---YRTATPSLSRN---S---------------ET
                                                                               

AFR304W            LWGT------RTVRYIPAVILGLLLNILDALSYGMIIFPIAEPIFSHLGPHGLSMFYVST
KLLA0E04731g       HYDKARDLMLRIFQYTPAVGLGLLLNILDALSYGMIIFPITEPLFSHLGPTGLSMFYVST
TBLA0C04440        FKDMLTKHSLQILHDIPACILGLLLNILDALSYGMILFPITDSVFGHLGPTGLSMFYIST
TPHA0D04210        NESKLIDFS-QILHYFPAAVLGLLLNILDALSYGMIIFPITEPIFANMGTAGISMFYISS
Kpol_480.18        TSSSFATKGLELLNYLPAAILGLLLNILDALSYGMIIFPITEPLFSGLGPTGISMFYIST
SAKL0F02926g       YYDYAKGWSIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGLSMFYVST
KLTH0F14674g       MRDKTLFTFRRLGNYVPAVILGLLLNILDALSYGMIIFPITEPLFSHLGPSGLSMFYMSS
Kwal_55.21201      LREKMMFTARRMVNYMPAVILGLLLNILDALSYGMIIFPITEPLFSHLGPTGMSMFYVSS
CAGL0I10626g       TAKAWMTLK-RVTNYMPAAILGLLLNILDALSYGMIIFPITEPIFAQLGPTGISMFYIST
KNAG0B00860        KWDYISALSHDIVHYLPASILGLLLNILDALSYGMIIFPITEPIFSQLGPSGLSMFYIST
TDEL0D05530        LWRQFMSSSSKLVHYLPATILGLLLNVLDGLSYGMIIFPITEPIFSHLGPSGLSMFYVST
KAFR0C01910        INEKLSTFFYNTLQYFPASVLGLLLNILDALSYGMIIFPISEPIFSHLGPTGMSMFYIST
ZYRO0C07986g       ----IVQFGQDVLHYFPSAVLGLLLNILDGLSYGMIIFPITEPIFSHLGSTGLSMFYIST
Suva_7.413         VWQWFTSFPSKFAQYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYIST
Skud_7.436         IWQWCTSFPFKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYIST
Smik_6.221         FRRLCTSFPSKFIHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYIST
YGR125W            LWHMCTSFPSKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYIST
NDAI0G00990        TWRKYIATPSEIIQYLPASILGLLLTILDALSYGMIIFPITEPIFSHLGPTGISMFYIST
NCAS0E00950        IWQNIADFPYQFIHYLPAAVLGLLLNILDALSYGMIIFPITEPIFSHLGPTGLSMFYIST
                                .  *:  *****.:**.******:***::.:*. :*. *:****:*:

AFR304W            IISQLVYSGGFSSFGYGTGSEMIEVTPFFHTMALSIKNSLSAEKS--DDIITTTIVCYAL
KLLA0E04731g       VICQLCFSLGLSSFPSAIGSEMIEITPFFHTMALSIMNSIPEGND--NKVISTTIVCYAL
TBLA0C04440        IISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNSIPSKDQ--NEIITTTIFCYVI
TPHA0D04210        IICQYILSGGFSSFPTGIGSEMIEITPFYHTMALAIKNSL--DVQ--EEIISTTIFCYVI
Kpol_480.18        IVCQLVLSGGFSSFPCGIGSEMIEITPFYHTMAFAIKDALP-NQD--NEVITTTIFCYVI
SAKL0F02926g       ILSQLVYSCGFSAFGNGIGSEMIEITPFFHTMALSIMNSLP-GHD--DEIISTTIVCYAL
KLTH0F14674g       VVSQLVYSCGFSAFGNAVGSEMIEITPFYHSMAASIMASMP-GEK--DRVLTTTIVCYAM
Kwal_55.21201      IISQLIYSGGFSAFGNAVGSEMIEITPFYHAMAASIVAGLP-GEK--DRVLSTTIVCYAL
CAGL0I10626g       IISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAISQALP-GRD--DEIITTTIFCYVI
KNAG0B00860        VISQFTYSSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTLGEERK--NEIITTTIFCYVI
TDEL0D05530        IISQVIYSSGFSNFPTGVGSEMIEVTPFFHSMALAIKDALP-GRD--DEILTTTIFCYVI
KAFR0C01910        IICQFIYSSGWSSFPSCIGSEMIEITPFFHTMAFAIMRSLP-GEENQDAIITTTIFCYVI
ZYRO0C07986g       IISQCLYSGGLSSFTSGIGSEMIEVTPFFHTMAFAIRDAIP-GQD--DDIITTTIFCYAI
Suva_7.413         IISQSVYSGGWSSFPSGVGSEMIEITPFYHTMALGIKEALV-GSD--DEIITTTIFCYVI
Skud_7.436         IISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAVKDALE-GND--DEIITTTIFCYVI
Smik_6.221         IISQAVYSGGCSSFPSGIGSEMIEITPFYHTMALAVKEALA-GDD--DEIITTTIFCYVI
YGR125W            IISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAIKEALA-GND--DEIITTTIFCYVI
NDAI0G00990        IISQSIFSGGWSSFPCGIGSEMIEVTPFFHTMAFAIKDALPEGSN--DDIITTTLFCYVI
NCAS0E00950        IISQTIYSSGWSSFPSGIGSEMIEVTPFFHTMALAIKETLP-GRD--DEIITTTIFCYVI
                   ::.*   * * * *    *.****:.**:*:**  :   :    .  : :::**:.**.:

AFR304W            STIITGAVFLTLGKLRLGKLVSFFPLHILIGCIGGVAYFLIITGIEVSTRVTKFEYSLAF
KLLA0E04731g       SSIITGLTFFLLGKMRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVCTRVPEFKYSWQF
TBLA0C04440        SCIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIVTGIEVTTRVKKLEYSLEF
TPHA0D04210        SSLVTGLVFYSLGKLKLGKIVAFFPRHILIGCIGGVGYFLVVTGLEVTTRVAKVEYSWEF
Kpol_480.18        SSVVTGLVFFMLGKLKMGKIVGFFPRHILIGCIGGVGYFLIITGIEVSTRIGKFEYNWEF
SAKL0F02926g       SSIFTGLAFFLLGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFEYSWPF
KLTH0F14674g       SSIMTGLVFFLLGRLKLGKIVGFFPRHILIGCIGGVGYFLVITGFEVTTRASKFEYSFEF
Kwal_55.21201      SSIITGLVFFLLGRLRLGKIVGFFPRHILIGCIGGVGYFLLITGLEVTTRVAKFEYSFEF
CAGL0I10626g       SSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVTTRIAKFEYSIPF
KNAG0B00860        SSMFTGLTFFTLGKLKLGKLVGFFPRHILIGCIGGVGYFLLITGIEVCTRIAKFEYSIPF
TDEL0D05530        SSLVTGLTFYVLGKMKLGKIVGFFPRHILIGCIGGVGYFLVVTGLEVTTRVAKLEYTWPF
KAFR0C01910        SSMFTGLTFLTLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGIEVTTRIAKFEYSLPL
ZYRO0C07986g       SSVVTGITFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGLGVTTRLAKIEYTWEF
Suva_7.413         SSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPF
Skud_7.436         SSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPF
Smik_6.221         SSMLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPF
YGR125W            SSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPF
NDAI0G00990        SSMLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLIITGIEVSTRVAKFQYTIPF
NCAS0E00950        SSMLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLLVTGIEVTTRVAKFEYSIPF
                   * :.** .*  **.:.:**:*.*** ******:***.***::**: * **  :.:*.  :

AFR304W            LRNLFMDPDILAKWLIPALLAVSIILLQRRIHNSMLLPLFYLSAFALFHFIVALIPSLSL
KLLA0E04731g       LSSLFTDFDILLKWLTPVILTLILISVQSRIHNSLVLPSFYIITLLLFHFVVALVPSLSL
TBLA0C04440        LLSVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFYIITFIAFHFIVALVPNLSL
TPHA0D04210        LSYLLSDFNIIGKWLTPILLTTILIFTQHHFQNSLVLPSFYIITIILFHFIVALVPMLSL
Kpol_480.18        LLSLLTNLDTLGKWLLPTLLTLSLILIQRQVQNSLVLPSFYILTIILFHFIVAILPNLSL
SAKL0F02926g       LRELFYNTEVLGKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIVPNLSL
KLTH0F14674g       LSSLLTDPEILGKWGLPALMAVLLVVIQRACKNSLVLPTFYIAALLLFHFIVALIPSLSL
Kwal_55.21201      LSSLFTNIEVLGKWGLPALMAVLLVVVQHAFGNSLVLPAFYIAALLLFHFIVALIPSLSL
CAGL0I10626g       LTKLFLDSSMLFKWLLPTILTIILIVTQKCFKNSLVLPSFYIITLILFHFVVAIAPNLSL
KNAG0B00860        LLNLFTDEKTLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIVAIVPNLSL
TDEL0D05530        ISHMFTDVSTLVKWVLPVLLTVLLIVTQRHFQNSLVLPTFYIATLVAFHFVVAIIPNVSL
KAFR0C01910        IKELFTDTSMLWKWLTPTLLTVVLILTQKCFKRSLVLPSFYIATLILFHFIVAIIPRLSL
ZYRO0C07986g       LKKLFLDTDILWKWLLPVVLTILLVNTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISL
Suva_7.413         VSGLFTNYDTLAKWLLPVLLTVVLIGTQRCFKNSLVLPTFYILTLVLFHFIVAIIPTLSL
Skud_7.436         FSGLFTNYDTLAKWLLPVLLTVILIGTQRYFKNSLVLPTFYILTLVLFHFIVAIIPTLSL
Smik_6.221         FLGLFTNYDTLAKWLLPVILTVILIGTQRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSL
YGR125W            FSGLFTDYDTLAKWLLPVLLTVVLIGTQRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSL
NDAI0G00990        ITHLFTDVVTLWQWLLPTLLTVILIIAQKCAQNSLVLPSFYILTLILFHFMVAIIPSLSL
NCAS0E00950        LASLFSDWATLWKWLLPVLLTVILIVTQRCFKNSLVLPSFYILTLILFHFIVAIIPSLTL
                   .  :: :   : :   *  ::  :   *    .*::** **: ::  ***:**: * ::*

AFR304W            DTLRDKGWIFPLTESGGRWYDYLELYNPQRIHWELVLGEIPTMLALTFFGILHVPINVPA
KLLA0E04731g       DKLRDFGWIFAKVNAKENWYDFYKLYDFKNVQWSLIPKQVPTMLALTFFGILHVPINVPA
TBLA0C04440        DSLRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIPTMFALTFFGILHVPINVPA
TPHA0D04210        NKLRDSGWIFPLTNSNDKWFDHYKYFNVYNVSWVLILKQMPTMLALTFFGILHVPINVPA
Kpol_480.18        DHLRENGWIFPVTDSKNSWYDHYKYFNLHDIHWGLVLKQIPTMLALTFFGILHVPINVPA
SAKL0F02926g       NSLRESGWIFPMAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVPINVPA
KLTH0F14674g       HSLRDSGWVFPATTTTEHWFDFYKLYNFKLVSWPLVLKQVPTMLALTFFGILHVPINVPA
Kwal_55.21201      DILRDSGWIFPATDSTEHWFDFYTLYNFKLVSWPMILKQIPTMLALTFFGILHVPINVPA
CAGL0I10626g       HQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPTMLALTFFGILHVPINVPA
KNAG0B00860        TKLRNSGWIFPVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGILHVPINVPA
TDEL0D05530        GKLRNMGWIFPVAASKDQWYDHYKLFQPHRVHWGLIAKQAPTMLALSFFGILHVPINVPA
KAFR0C01910        TQLREAGWIFSNTAPNSAWYDHYKLFDFHKVHWLLVFKQIPTMLALTFFGILHVPINVPA
ZYRO0C07986g       DQLRDLGWIFPAATSKDRWFDHYKLFDWHKVHWNLVLAQIPTMLALTFFGILHVPINVPA
Suva_7.413         DTLRDSGWIFPIASSDSKWYDHYKLFNIHKVHWTLVLQQIPTMMALTFFGILHVPINVPA
Skud_7.436         DTLREAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPA
Smik_6.221         DTLRAAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPA
YGR125W            DALRQAGWIFPIANSDSKWYDHYRLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPA
NDAI0G00990        NQLRDSGWIFPQAATDSKWYDHYKLFNLHKVHWTLILKQIPTMLALTFFGILHVPINVPA
NCAS0E00950        NQLRDSGWIFPIAISNSKWYDHYKLFDFKKVHWTLVFKQIPTMLALTFFGILHVPINVPA
                     **  **:*.       *:..   ::     * ::  : ***:**:*************

AFR304W            LAISCGIDKIDVDKELIAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAGFLLAI
KLLA0E04731g       LAMSLNVDKYDVDKELIAHGYSNLISGFLGSIQNYLVYTNSVLFIRAGADSPIAGIMLTI
TBLA0C04440        LAMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAG
TPHA0D04210        LAMSLNIDKFDVDREFIAHGYSNFLSGLFGSVQNYLVYTNSVLFIRAGADSPIAGYLLIV
Kpol_480.18        LAMSLHMDKYDVDRELIAHGYSNLISGLLGSVQNYLVYTNSVLFIRAGADSSSAGFLLVA
SAKL0F02926g       LAMSIGMDKFDVDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLAL
KLTH0F14674g       LAMSIGLDKLDVDKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAA
Kwal_55.21201      LAMSIGLDKLDVDKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRAGGDDALAGLMLAA
CAGL0I10626g       LAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAGYVLIV
KNAG0B00860        LAMSLQMDKYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYILIV
TDEL0D05530        LAISLQMDKYDVDKELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAF
KAFR0C01910        LAMSVQMDKYDVDKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIF
ZYRO0C07986g       LAISLHMDKFDVDKELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAI
Suva_7.413         LAMSLQMDKYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVA
Skud_7.436         LAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIA
Smik_6.221         LAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIA
YGR125W            LAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSPFAGFLLIA
NDAI0G00990        LAMSLQMDRYDVDKELIAHGVSNFVSGMFGSIQNYLVYTNSVLFIRAGADSALAGHILIV
NCAS0E00950        LAMSLHLDKYDVDKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILII
                   **:*  :*. ***.*:**** **:.**  **::********.***.**.:   ** :*  

AFR304W            ATFMTMTAGPWIISIIPVCIVSSLIFLLGYELLKEVLYDSYNRLSNFEYITVVIIILTMG
KLLA0E04731g       GTFIVMVIGPVIISFIPICIVGSLIFLLGYELIQEAVIDTWGKLQPFEYLTIWIIVITMG
TBLA0C04440        FTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTKFEYITIMIIVFTMG
TPHA0D04210        LTAIVMLIGPVIISFIPICIVGSLIFLLGYELLIEALLDTVGKVTFFEYTTIIIIVFTMG
Kpol_480.18        LTVVVMVAGSVIVSFIPVCIVGSLIFLLGYELMVEALVDTIGTVTSFEYITILIIVFIMG
SAKL0F02926g       GTFVVMIIGPVIISFIPICIVGSLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVFTMG
KLTH0F14674g       ATFGIMVIGPVIVAYIPVCIVGSLIFLLGYELLKEALVDTWGKLNNFEYATVVAIVFTMG
Kwal_55.21201      ATFGIMIVGPVIVAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMG
CAGL0I10626g       LTIMVMVIGPVIISFIPICIVGSLIFLLGYELLVEAMIDPFGKVTTFEYATIGIIVLTMG
KNAG0B00860        LTIIVMLIGPVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTMG
TDEL0D05530        LTFIMMVIGPVIISYIPICIVGSLIFLLGYELLYEALIETRGKVTNFEYITICIIVLTMG
KAFR0C01910        LTIVVMLIGPVIISFIPICIVGSLIFLLGYELLVEALLDTWDKLTTFEYVTVVVIVLTMG
ZYRO0C07986g       LTFAVMVIGPVIVSFIPICIVGSLIFLLGYELLVEALLDTRGKVTNFEYITIVIIVLTMG
Suva_7.413         LTVCIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWSKLNRFEYLTVVIIVFTMG
Skud_7.436         LTICVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMG
Smik_6.221         LTICIMMIGPVIISFIPICIVGSLIFLLGYELLVEALIDTWNKLNRFEYLTVVIIVFTMG
YGR125W            LTICIMIIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMG
NDAI0G00990        LTIIIMIIGPVIISFIPICIVGSLIFLLGYELLVEALVDPLGKISKFEYITIVIIVFTMG
NCAS0E00950        LTAIVMFIGPVIISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYITIVIIVLTMG
                    *   :  *. *:: **:***.*******:**: *.: :. . :  *** *:  *:: **

AFR304W            IFDFVLGIIVGVLVACFSFLVESTRAKTISSEFDGKVAKSACHRDYLQSNFLEKVAEQIY
KLLA0E04731g       VVDFVIGIIVGILLACFSFLVNSTQLQTINGEYDGKVAKSTVYRDYIQSKFLRNIGEQIY
TBLA0C04440        IYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQSQFLSGIAEQIY
TPHA0D04210        IYDFVLGIIVGILLACIKFMVDGTKLQTINTEYDGTIAKSTVYRDFIQSKFLDGIGEQIY
Kpol_480.18        IYDFVLGIIVGILIACLSFMVDGTKLETINGEYDGQVAKSTVYRDYIQTKFLNGIRQQIY
SAKL0F02926g       VFDFVLGIIVGILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKVGEQIH
KLTH0F14674g       AFDFVLGIIVGILIACFSFLVDSTKLQTINGEFDGQVARSTVRRDYIQTQFLNKIGEQIH
Kwal_55.21201      AFDFVLGIIVGILIACFSFLVDSTKLQTVNGEFDGQVARSTVSRDYIQTQFLNKIGEQIH
CAGL0I10626g       IFDFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKSTVYRDFTQTRFLSQIGEQIY
KNAG0B00860        IFDFVLGIIVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGVGEQIY
TDEL0D05530        IFDFVLGVIVGILIACFSFLVDSTKLQTINGEYDGKIAKSTVYRDYVQSRFLDGIGEQIY
KAFR0C01910        IVDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTVNRDLIQSKFLNGIGDQIY
ZYRO0C07986g       IYDFVLGVIVGILIACFSFLVDSTKLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIY
Suva_7.413         IFDFVLGIIVGILIACFSFLVDSTKLQTVNGEYNGNVAKSTVYRDYVQTKFLDGIGEQIY
Skud_7.436         VFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIY
Smik_6.221         IFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIY
YGR125W            IFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVARSTVYRDYVQTKFLDGIGEQIY
NDAI0G00990        IFDFVLGVIVGILIACFSFLIDSTKLQTINGEFDGTVAKSTVYRDLIQTKFLNGIGEQIY
NCAS0E00950        IFDFVLGIIVGILIACFSFLIDSTKLQTINGEYDGTVAKSTVYRDLIQTKFLNGIGEQIY
                     ***:*::**:*:**:.*:::.:. :*:. *:.* :*.*:  **  *: **  : :**:

AFR304W            VLKLQNNLFFGTIISIEEKIGNLLEPNG--SEYKKIIKYLILDFKHINIDNIDYSAAEGF
KLLA0E04731g       VLKLQNILFFGTIISIEEKVNSLLEICE-SDSSKKRIKYLILDFKNIRAKSIDYSAAEGF
TBLA0C04440        VLKLQNVLFFGTIISIEEKIDMLLEISD-NDSSKRRIKYLILDLKNVNSDNIDYSAAEGF
TPHA0D04210        LIKLQNVLFFGTIISIEEKIDTLLQLSD-SDSSKHRIRYLILDFKNINDDNIDYSAAEGF
Kpol_480.18        LLKLQNVLFFGTIISIEEKIDKLLEISD-KDPSKRRIKYLILDFKNINADNIDYSAAEGF
SAKL0F02926g       VLKLQNLLFFGTIISIEEKIDGLLEISD-KDSSRQRIKYLILDFKNINADNIDYSAAEGF
KLTH0F14674g       VLKLQNLLFFGTIISIEEKIDKLLELSD-KDASKKRIKYLILDFKNINADNIDYSAAEGF
Kwal_55.21201      VLKLQNLLFFGTILSIEEKIDKLLELSD-KDSSKKRIKYLILDFKNINADNIDYSAAEGF
CAGL0I10626g       VLKLQNILFFGTIISIEEKIERLLEISD-NDVSKHRIKFLILDFKNINADNIDYSAAEGF
KNAG0B00860        VLKLQNLLFFGTIISIEEKIDKLLEISN-NDSSKRRIKYLILDFKNINTDNIDYSAAEGF
TDEL0D05530        VLKLQSLLFFGTIISIEEKINKLLEISDDQKNSKRRIKCLILDLKNINADNIDYSAAEGF
KAFR0C01910        VLKLQNLLFFGTIISIEEKIDKLLEMSD-RNSSKRQIKYLILDFRNINADNIDYSAAEGF
ZYRO0C07986g       VLKLQNVLFFGTIISIEEKIDKLLEITDSKSSSKRRIKYLILDFKNINADNIDYSAAEGF
Suva_7.413         VLKLQNVLFFGTIISIEEKIERLLEISN-KDSTKRRIKYLILDFKNINADNIDYSAAEGF
Skud_7.436         VLKLQNVLFFGTIISIEEKIEKLLQISN-KDAKKRRIKYLILDFKNINADNIDYSAAEGF
Smik_6.221         VLKLQNLLFFGTILSIEEKIEKLLQISN-KDATKRRIKYLILDFKNINADNIDYSAAEGF
YGR125W            VLKLQNLLFFGTIISIEEKIERLLQISN-KDATKRRIKYLILDFKNINADNIDYSAAEGF
NDAI0G00990        VLKLQNLLFFGTIISIEEKIDKLLEISD-MDSSKHRIKYLILDFKNINADNIDYSAAEGF
NCAS0E00950        VLKLQNLLFFGTIISIEEKIDELLEICH-KDSSRLRIKYLILDFKNINADNIDYSAAEGF
                   ::***. ******:*****:  **:     .  .  *. ****:.::. ..*********

AFR304W            NRIKRVMEIKRIKLIVSSISECDKIYTIFSKIGLLQDVELFQDLNSALEWCENELLCEYR
KLLA0E04731g       NRIKRFLEKERIHLIISSIDKEDQIYLAFDKVRLFENVELFSDLNGALEWCENEFLMRYK
TBLA0C04440        NRIKRFTQSKRIQLIISSIKDTDKIYKMFNNVNLLENVELFSDLNGALEWCENEFLYQYR
TPHA0D04210        NRIKRFTHGRHIKLIISSITHTDKIYKAFNKIGLLQDIELFSDLNNGLEWCENKYLEKYR
Kpol_480.18        NRIKRFTQGKRIQLIISSIKEKDKIYSVFNMVRLLEDVELFDDLNSALEWCENEFLYQYM
SAKL0F02926g       NRIKRFTETKRIQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENEFLLQYK
KLTH0F14674g       NRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVELFDDLNSALEWCENEFLRQFR
Kwal_55.21201      NRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVELFDDLNSALEWCENEFLIQFK
CAGL0I10626g       NRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELFNDLNSALEWCENEFLYQYK
KNAG0B00860        NRIRRFTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCENELLHWYN
TDEL0D05530        NRIKRFTQSKHIQLIISSISETDHIYTAFSKVKLLDDVELFGDLNGALEWCENELLFKYK
KAFR0C01910        NRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVELFNDLNGALEWCENEFLYQYK
ZYRO0C07986g       NRIKRFTQTKRIKLIISSIKERDHIYNVFSNVGLLDDVELFNDLNGALEWCENEFLGEYK
Suva_7.413         NRIKRFTETKRIKLIISSIKERDHIYNAFNNVGLLNDVELFADLNGALEWCENEFLFQYK
Skud_7.436         NRIKRFTGTKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYK
Smik_6.221         NRIKRFTETKKIKLIISSIRERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYK
YGR125W            NRIKRFTETKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYK
NDAI0G00990        NRIKRFTQTKRIRLIISSIRERDHIYNAFNNVGLLEGVELFNDLNSALEWCENEFLFKYK
NCAS0E00950        NRIKRFTQTKKIQLLISSIKERDHIYKAFDNVGLLKGVELFNDLNSALEWCENEFLFKYK
                   ***.*      *.*::*:*   * **  *. :  : .:*** ***..******: *  : 

AFR304W            SLLSRAHRVK--VRRRSKDIVPKA-----------------------------QIPLENT
KLLA0E04731g       RIRTKTRARKLAQLKKSQNRMSK-------------------------------LPV-NT
TBLA0C04440        QVKNKARARAKRKATSRDVVRTGYLSTS-------------VSNTLNDRKSSGNLPI-NT
TPHA0D04210        ELHEKAKKRL----HSRMSILQDKNISSRQ-----INSTSSDGNEYQSSQRLMSLPL-NT
Kpol_480.18        QLHEKAKDRI----HKRISISKDSGSTYFSR------NRSDSGLSAADQQMLMSLPI-NT
SAKL0F02926g       QIRTRTKAKLQAQKKQEKHLSKSL------------------------------LPI-NT
KLTH0F14674g       DLRNKTKLKAVRKQERQLSKGA--------------------------------LPF-NT
Kwal_55.21201      DLRNKTKLKAGKKQDRRMSKVP--------------------------------LPF-NT
CAGL0I10626g       ELREKARNKL---QRRSKNINAAIGNQLRRY----DQTNKNQGPTSSLMQNLMSLSN-NT
KNAG0B00860        ELRTKAKARLRKLNNTANSVVSRLPVSASKQMDSRAITSADQSGRAAIS-NLMSLPT-NT
TDEL0D05530        ELRAKARDRL--QNKMQMANLAANNDTK-------AIDGVPKSHHMQ---NLMSLPF-NT
KAFR0C01910        MIRERIKIKNVKTATHSSDGNLSKPSA-------------------------MTLSI-NT
ZYRO0C07986g       KLRDRAREKM----QHSYNVTSAIEAAAAKKVPTDNNQISKKNLSLLNFRNLSSLPM-NT
Suva_7.413         QLREKAKKRL--EERKQNNVVSAIMAATQNKKIDRSGIDLNKGGNRDQARHLMSLPT-NT
Skud_7.436         QLREKAKKRL--EERKQSSVASAIMAATQNKKIDGLGNGLSTGENRDHARNLMSLPT-NT
Smik_6.221         QLRIKAKERL--EERKQNNIVSAVMAATQNKNINALGNGLNKGNNIDPVRNLMSLPT-NT
YGR125W            QLRKKAKERL--EEGKQNNVVSAVIAATKNKKIDTIGNGLNRGSNGDTARNLMSLPT-NT
NDAI0G00990        TLREKTRQKRKNKIDINLAITNGNPTEE-------------RNMHLEIPRNIMSLPM-NT
NCAS0E00950        QLRDKAKSRL--HRKQIIDINASIGSQKYQ-----FTAGNDKKSNLDIPRNLMSLPI-NT
                    :  . .                                               :.  **

AFR304W            PRNAQIMTAAQAVY-SGEQQLNKTLSK--YKASHPALALLLVALKTYRSG----HAYKET
KLLA0E04731g       PRNHQFVSEVRNIY-TEEMEIQKLSNE--LKERQQFLPIFLMSIRKFRNAIQSPNELKRT
TBLA0C04440        PRNHQMVSVAKNIFQNIEQPVRSFSTN--LNKSIPVLELLVFALKQYRSDIFSDDNKVRD
TPHA0D04210        PRNHQLLSVARNVFKNETQAVSRFKNL--DNGEDAFTQLLLQSIRRFRPDVFSESKDIRA
Kpol_480.18        PRNNQVLSVARKVFKNEAQTASKFKTH--NETDKPVLSLLLYSIRLFRPDVFSEDVSIRE
SAKL0F02926g       PRNNQIVTVAQKIF-PDEQNVTHLRTQ--YQKREPVLPLLLVALKKFRPQIMSYDKDVKQ
KLTH0F14674g       PRNNHFVSVAQKLF-TDEQSMPHLKTH--YKEKTPVLHLLLSALQRYRPEIMSPEKPVKE
Kwal_55.21201      PRNNQFVSVAQKLF-TDEQSMTHLKSS--YRERPPVLPLLLSALQRFRPQIMSSDKSVKE
CAGL0I10626g       PRNYQLVSAAQQAFSNEQQISTEIDTK--LKIPDPLLKVLLFALKLYRPNIVSMDTEKRT
KNAG0B00860        PRNHQMLTVAQDVFKNDEQTVSSLRKQ--LKTKDPLLPLLLLTLKQYRPDIGSNDKLARD
TDEL0D05530        PRNDQMLSVAQRVFKNEQKTVDSLKVN--YKELPPVLPLLLFALKPYRPGILSEDTNVKN
KAFR0C01910        PRNYQIYSVAQNIFKNEEQTVDRLKNR--FQDQTPVLPLLLFALKQYRPDIVSVDKVKKG
ZYRO0C07986g       PRNHQMLSVAQNMF-NDEEDVDALEDESCNDGQQPVLPLLLFALKSYRKNITSTDPHLRE
Suva_7.413         PRNHQMLSVAQNVFANDEQAVKNLKKE--YKEDEPVLPILLFALKQYRPDIVSEVQKVRE
Skud_7.436         PRNYQMLSVAQNVFVNDEQAVKNFKME--YKNDEPILPILLFALKQYRPDIISEIQTVRE
Smik_6.221         PRNYQMLSVAQNVFVNDEQAVKNFKKE--YKDDEPVLPILLFALKQYRPDIISEIQKVRE
YGR125W            PRNYQILSVAQNVFVNDEQAVKNFKKE--YKDDEPVLPILLFALKQYRPDIISEVQKVRE
NDAI0G00990        PRNNQMLSVAQNVFRNEEQAAKALKQQ--FKNEPSVLPLLLFVLKQYRPRIVSNDKSIEE
NCAS0E00950        PRNHQILSVAQNVFQNEEQTVKNLKTE--LKDQAPFLPLLLFTLKQYRPGIISTDKTVKE
                   *** :. : ..  :                        :::  :. :*            

AFR304W            KEIRLWKHLCPYFVRKSFSPQTSISDEGDMFFVVESGLLKITYMLPQGSLQEAIASKTCY
KLLA0E04731g       NELDLWKRLISYFQQKKFPPNTEIRHRNNMFIVVESGVLNLTHHLIQGEFYETMSPKTAY
TBLA0C04440        KEVEFWSQLCPYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGSVYETMSNRTCY
TPHA0D04210        QEIKFWTQLAPYFNKIFVETNSTFLNENNFFFLLDSGVIKVTHDLAPGKLSETMLSRTSY
Kpol_480.18        KEINFWGQLSPYFRRSLFPTGSTLVNSSNFFFVVESGVVRVTHDLPQGIVSETMSNRTCY
SAKL0F02926g       AEEDFWSKLCPYFVRKRFAPGSLLLHNNNLFFLVESGMLKITYDLHQGQFYETMSSKTCY
KLTH0F14674g       TEEKMWSELGKFFFKRRLAAQSLLPHKNNIFLVVESGMVKVTYNLRQGQLYEILSGKTCY
Kwal_55.21201      GEERLWSDLCKYFYKKRLAAHSLLLHKDNIFFVIETGMVKVTYNLRQGQLYETMSGKTCY
CAGL0I10626g       DEVEFWKQLCPYFTRKVFTANTTFLHNNNFFFLVDAGILKVIYNLPAGSVYETLSNGTCY
KNAG0B00860        KEIAIWSRLCPYFAKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMANRTCY
TDEL0D05530        SELELWSKLCPYFTRRRLASQSILLHNSDIFFVMETGILKIVYDLPQGIVYESLSNRTCY
KAFR0C01910        KEIEFWSQLAPYFSKKRIASQSILYHGNNIFFLVEIGVLKVTFDLPQGKVYETMSKRACY
ZYRO0C07986g       RETQLWSQLVPYFVKRRLTTQSILLHNQDFFFVVESGLLKIALDLPQGVVYETMSNRTCC
Suva_7.413         KEIKFWAQLCPYFSRRRLASQSLLLHADNVFFLIETGMLKAVYELPQGSLYEIMSNGTCF
Skud_7.436         KEIKFWAQLCPYFTRRRLASQSLLLHADNIFFLVETGMLKATYELPQGTLYEIFSNGTCF
Smik_6.221         KEIKFWAQLCPYFTRRRLASQSLLLHADNVFFLVETGMLKATYELPQGTLYEIFSNGTCF
YGR125W            KEIKFWAQLCPYFTRRRLASQSHLLHADNIFFLVETGMLKATYELPQGTLYEIFSNGTCF
NDAI0G00990        KEIKFWSQLCPYLSERFLVAQSTLKHNNNFFFIVESGILKATFTLPSGTLYETMSNRTCY
NCAS0E00950        NEIKFWSQLCPYFVKLPLASQSTLIHNNNIFFIVETGILKATFNLPQGNIYETMSNRTCY
                    *  :*  *  ::    .   : :    ..*:::: *::.    *  * . * :   :. 

AFR304W            GNISG--PGS----------LSYSSVVRTETECVLWMIDAPGLQKLQEENLPLYTELLVV
KLLA0E04731g       GVISN------------VNSDPLAVSITTDTECVLRYIDAESLADLKLTDPELFTELLIL
TBLA0C04440        GRILG--KGY-------LKKSTSPLNIKAETDCIIWLINSEGLDKMKAENLELYTELTLL
TPHA0D04210        GILSS--KNN-------RTYKTHKVTFIPETKSVIWLIDSEGLKKMEKENLKLYSELTLL
Kpol_480.18        GKVVG--HRG-------TVTNLPKIIFKTETESIIWMIDDDTMSRIKKENLNLYTELLLL
SAKL0F02926g       GRISG---NA-------EFTTNLYVNIKTETDCAVWIIDATNLANLKEKNLALYAELLLV
KLTH0F14674g       GRITA--PNS-------SEVPISSVEIKMETDCALWILDEANLAKLKKENLALYTELLLV
Kwal_55.21201      GRMSI--PNN-------NNNPISCVEVEMETDCSLWIIDDAGLAKLKRENLNLYTEVLLV
CAGL0I10626g       GKILS--KRD-------NENINQNLRVQVETDTILWIIDEKSMEIMKMDNIVLYTELVLL
KNAG0B00860        GKIID--SGTTVDDADTSNPDFSKLFITTETDSELWVIDAAAMGRLEREDPELFIQLALL
TDEL0D05530        GIVLN--PGT-------RPCSESKVTIKTETEVVLWVIDSSILARLKQENLSLYTELILL
KAFR0C01910        GKIMGKIPVS-----EADAPSSQAMIIKTEADTVIWIIDSSALKKMKDENIELYLELVLL
ZYRO0C07986g       GNIVG--SDY-------KSSEEHKVTIVTETDTCLWLIDVDGLQKLRAENLQLYTELVLL
Suva_7.413         GKIIA--PGN-------TMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVTLM
Skud_7.436         GKIIA--PGN-------AMPREQKLTIETETDSVLWVIDSSSLKKMKEENLALYVEVTLM
Smik_6.221         GKIIA--PGN-------AMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVALM
YGR125W            GKIIA--PGN-------AMPREQKLTIETETDSVLWVIDSSSLNKLKEDNLALYVEVALM
NDAI0G00990        GKILG--SNN-----ETTVLNEQDLTIKTETDCNLWVIDMDALTRMRAENLELYIELVLL
NCAS0E00950        GKITG--QHN--------ESTLKTLTIRAEIDSILWVIDSGSLIKMRAENAELFTELTLL
                   * :                       .  : .  :. ::   :  :   :  *: :: ::

AFR304W            YISVIQHRFKELLGHSLING
KLLA0E04731g       VMAIHRDRFRELLGYSLISM
TBLA0C04440        VMSVKDDRFNNLLGYALISA
TPHA0D04210        IMSISDYRFKALLGYTLVNA
Kpol_480.18        VMTIREYRYKGLIGYTLVSA
SAKL0F02926g       VMSINQYRSKELLGYSLVSS
KLTH0F14674g       TLCMNQDRLKELLGHCLVSS
Kwal_55.21201      TLCINQDRLKELLGHCLVSS
CAGL0I10626g       ILAIRDTRFKELLGYTLVSA
KNAG0B00860        VMLIKDKRFKDLLGHALISA
TDEL0D05530        IATVKEQRYRQILGYTLVSA
KAFR0C01910        VMTIKDIRFKSLLGHALVST
ZYRO0C07986g       CLLIKSRRFEQLLGYTLVSA
Suva_7.413         IMCIKDTRFKELLGYTLVSA
Skud_7.436         VMCIKDTRFKELLGYTLVSA
Smik_6.221         VMCIKDTRFKELLGYTLVSA
YGR125W            VMCIKDTRFKELLGYTLVSA
NDAI0G00990        IMSIRDTRFKELLGYTLVSA
NCAS0E00950        IMAVKDNRFKELLGYTLVSA
                      :   *   ::*: *:. 

FASTA FORMAT for MUSCLE Version 3.6

>AFR304W
-----MTKNRRFSAWSHRPSISEALNIQLNIPDS-----PSGGANAGGPVSERIPTL---
-----------MRPEAYLG-RSYV-GSFSNSG------SLMSREAG-----------AA-
---GPDSPPLPRF--RDQASSYVHNGSHLHRQTAALCDDSRAYDGGPEEEE--------A
LV----------FEGNMILQEGAPP--------------------------------RFG
VGPYNLCKVDSNISEVLLNVDEAV--DDSDSDQEAGTRLFLSPI-----------TTDYI
HSYGAINEE---------QSASETA---SRAETGPSPLR---------------------
LWGT------RTVRYIPAVILGLLLNILDALSYGMIIFPIAEPIFSHLGPHGLSMFYVST
IISQLVYSGGFSSFGYGTGSEMIEVTPFFHTMALSIKNSLSAEKS--DDIITTTIVCYAL
STIITGAVFLTLGKLRLGKLVSFFPLHILIGCIGGVAYFLIITGIEVSTRVTKFEYSLAF
LRNLFMDPDILAKWLIPALLAVSIILLQRRIHNSMLLPLFYLSAFALFHFIVALIPSLSL
DTLRDKGWIFPLTESGGRWYDYLELYNPQRIHWELVLGEIPTMLALTFFGILHVPINVPA
LAISCGIDKIDVDKELIAHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAGFLLAI
ATFMTMTAGPWIISIIPVCIVSSLIFLLGYELLKEVLYDSYNRLSNFEYITVVIIILTMG
IFDFVLGIIVGVLVACFSFLVESTRAKTISSEFDGKVAKSACHRDYLQSNFLEKVAEQIY
VLKLQNNLFFGTIISIEEKIGNLLEPNG--SEYKKIIKYLILDFKHINIDNIDYSAAEGF
NRIKRVMEIKRIKLIVSSISECDKIYTIFSKIGLLQDVELFQDLNSALEWCENELLCEYR
SLLSRAHRVK--VRRRSKDIVPKA-----------------------------QIPLENT
PRNAQIMTAAQAVY-SGEQQLNKTLSK--YKASHPALALLLVALKTYRSG----HAYKET
KEIRLWKHLCPYFVRKSFSPQTSISDEGDMFFVVESGLLKITYMLPQGSLQEAIASKTCY
GNISG--PGS----------LSYSSVVRTETECVLWMIDAPGLQKLQEENLPLYTELLVV
YISVIQHRFKELLGHSLING
>KLLA0E04731g
----------MSTAQNSSVSMSQSQSTAKNRKYS--------------------------
--------FQMPTTSTYLG-RSYV-GSFISPPMEYRSNSNTTSNNN-----------NNS
NVGDPFKSPF-----SSEGSKLIHESGNLHKQTAFLSNTFDNDAGNDEGAG--------F
PLDGNDDEFNLEQNDIDMIVEEDQMLQNSQRRRGRM-------------------SVDAA
ADIEADAHLMDLEDMALKRADDVGIFSTSFPGKDDSSFLDVSDSTENLALLPTNSHNSMY
VEYGTFDEENQP------ATQYISLLPDGASSGGFTSQGFRSS---------------MS
HYDKARDLMLRIFQYTPAVGLGLLLNILDALSYGMIIFPITEPLFSHLGPTGLSMFYVST
VICQLCFSLGLSSFPSAIGSEMIEITPFFHTMALSIMNSIPEGND--NKVISTTIVCYAL
SSIITGLTFFLLGKMRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVCTRVPEFKYSWQF
LSSLFTDFDILLKWLTPVILTLILISVQSRIHNSLVLPSFYIITLLLFHFVVALVPSLSL
DKLRDFGWIFAKVNAKENWYDFYKLYDFKNVQWSLIPKQVPTMLALTFFGILHVPINVPA
LAMSLNVDKYDVDKELIAHGYSNLISGFLGSIQNYLVYTNSVLFIRAGADSPIAGIMLTI
GTFIVMVIGPVIISFIPICIVGSLIFLLGYELIQEAVIDTWGKLQPFEYLTIWIIVITMG
VVDFVIGIIVGILLACFSFLVNSTQLQTINGEYDGKVAKSTVYRDYIQSKFLRNIGEQIY
VLKLQNILFFGTIISIEEKVNSLLEICE-SDSSKKRIKYLILDFKNIRAKSIDYSAAEGF
NRIKRFLEKERIHLIISSIDKEDQIYLAFDKVRLFENVELFSDLNGALEWCENEFLMRYK
RIRTKTRARKLAQLKKSQNRMSK-------------------------------LPV-NT
PRNHQFVSEVRNIY-TEEMEIQKLSNE--LKERQQFLPIFLMSIRKFRNAIQSPNELKRT
NELDLWKRLISYFQQKKFPPNTEIRHRNNMFIVVESGVLNLTHHLIQGEFYETMSPKTAY
GVISN------------VNSDPLAVSITTDTECVLRYIDAESLADLKLTDPELFTELLIL
VMAIHRDRFRELLGYSLISM
>TBLA0C04440
--MVYAQQDSDNNSNRERNKLSEAISISLGLQEQ----QGNDNDKYNNDNSNIHGTLNNS
RQRRKPSISLDPTLSRNIGARSFNCGAFLSRSIDNNLPTTDMFNSSTFRSSNSNNYFTHG
LNSNNDHLPVI----NPFPKSSIHGSDNLHKRTAEISNEFNNSPTDTEDDNANTETPNIP
STAQSSNNLNDSNDFMIELDGNNNTNNSNNIVSSELPPTATSMFNNTNSTATSVQSLKIG
NNEILKTISGDNGGIVNRLPIQEL--DEDIIDNDEYSRLLPTPS-------PSIYDDENA
LFFSSSNNYDSTDLE---NNNYISS---SIPTTTDVTQS--TS---------------LS
FKDMLTKHSLQILHDIPACILGLLLNILDALSYGMILFPITDSVFGHLGPTGLSMFYIST
IISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNSIPSKDQ--NEIITTTIFCYVI
SCIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIVTGIEVTTRVKKLEYSLEF
LLSVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFYIITFIAFHFIVALVPNLSL
DSLRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIPTMFALTFFGILHVPINVPA
LAMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAG
FTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTKFEYITIMIIVFTMG
IYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQSQFLSGIAEQIY
VLKLQNVLFFGTIISIEEKIDMLLEISD-NDSSKRRIKYLILDLKNVNSDNIDYSAAEGF
NRIKRFTQSKRIQLIISSIKDTDKIYKMFNNVNLLENVELFSDLNGALEWCENEFLYQYR
QVKNKARARAKRKATSRDVVRTGYLSTS-------------VSNTLNDRKSSGNLPI-NT
PRNHQMVSVAKNIFQNIEQPVRSFSTN--LNKSIPVLELLVFALKQYRSDIFSDDNKVRD
KEVEFWSQLCPYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGSVYETMSNRTCY
GRILG--KGY-------LKKSTSPLNIKAETDCIIWLINSEGLDKMKAENLELYTELTLL
VMSVKDDRFNNLLGYALISA
>TPHA0D04210
-------MPSRKKERRVSSSFSEALSVSLGLQEQGNLRSTERANVKRNAIFDEFPLEST-
-----------NSLTLPDS-MSMK-NNTVNIN------DKLVPDNS-----------KNR
TFYNDSIYPPE----NKTSMKSITVADILHRQTAELSKTFYDSNFTD------------K
DV----------KDYIDIIDNDVAT---------------------------------SN
ESDSNSTPEPYLGDEYDQHRLAIRTQKSPNIADDEQSRLLTPSS----------------
-SIIGAELDL--------EAHYDEF---EPVRMDASSIN-------------------RQ
NESKLIDFS-QILHYFPAAVLGLLLNILDALSYGMIIFPITEPIFANMGTAGISMFYISS
IICQYILSGGFSSFPTGIGSEMIEITPFYHTMALAIKNSL--DVQ--EEIISTTIFCYVI
SSLVTGLVFYSLGKLKLGKIVAFFPRHILIGCIGGVGYFLVVTGLEVTTRVAKVEYSWEF
LSYLLSDFNIIGKWLTPILLTTILIFTQHHFQNSLVLPSFYIITIILFHFIVALVPMLSL
NKLRDSGWIFPLTNSNDKWFDHYKYFNVYNVSWVLILKQMPTMLALTFFGILHVPINVPA
LAMSLNIDKFDVDREFIAHGYSNFLSGLFGSVQNYLVYTNSVLFIRAGADSPIAGYLLIV
LTAIVMLIGPVIISFIPICIVGSLIFLLGYELLIEALLDTVGKVTFFEYTTIIIIVFTMG
IYDFVLGIIVGILLACIKFMVDGTKLQTINTEYDGTIAKSTVYRDFIQSKFLDGIGEQIY
LIKLQNVLFFGTIISIEEKIDTLLQLSD-SDSSKHRIRYLILDFKNINDDNIDYSAAEGF
NRIKRFTHGRHIKLIISSITHTDKIYKAFNKIGLLQDIELFSDLNNGLEWCENKYLEKYR
ELHEKAKKRL----HSRMSILQDKNISSRQ-----INSTSSDGNEYQSSQRLMSLPL-NT
PRNHQLLSVARNVFKNETQAVSRFKNL--DNGEDAFTQLLLQSIRRFRPDVFSESKDIRA
QEIKFWTQLAPYFNKIFVETNSTFLNENNFFFLLDSGVIKVTHDLAPGKLSETMLSRTSY
GILSS--KNN-------RTYKTHKVTFIPETKSVIWLIDSEGLKKMEKENLKLYSELTLL
IMSISDYRFKALLGYTLVNA
>Kpol_480.18
MNNNQNYSGQDSSNRRVRPSFSEALSVSLGLHEQGIGAGRTRSNLAPNSYSGYNDNTTS-
--------SVSNREFGRIG-RSYA-GSISSNS------PSLYLNTS--------------
--RTDELLPI-----RKMPSKSILGPDALHRQTAEISNDFNDTSM----DE--------A
KI----------KRYIELLNRKQIE-----AEEEG------------------------E
ESAVHLRPHTFIEGKSFLSPIGSS--ASQLDGLEQ--RALLTPS----------------
SSIVGNEFDL--------ESTYDEI---NNDYNSILRIQ--SR---------------EL
TSSSFATKGLELLNYLPAAILGLLLNILDALSYGMIIFPITEPLFSGLGPTGISMFYIST
IVCQLVLSGGFSSFPCGIGSEMIEITPFYHTMAFAIKDALP-NQD--NEVITTTIFCYVI
SSVVTGLVFFMLGKLKMGKIVGFFPRHILIGCIGGVGYFLIITGIEVSTRIGKFEYNWEF
LLSLLTNLDTLGKWLLPTLLTLSLILIQRQVQNSLVLPSFYILTIILFHFIVAILPNLSL
DHLRENGWIFPVTDSKNSWYDHYKYFNLHDIHWGLVLKQIPTMLALTFFGILHVPINVPA
LAMSLHMDKYDVDRELIAHGYSNLISGLLGSVQNYLVYTNSVLFIRAGADSSSAGFLLVA
LTVVVMVAGSVIVSFIPVCIVGSLIFLLGYELMVEALVDTIGTVTSFEYITILIIVFIMG
IYDFVLGIIVGILIACLSFMVDGTKLETINGEYDGQVAKSTVYRDYIQTKFLNGIRQQIY
LLKLQNVLFFGTIISIEEKIDKLLEISD-KDPSKRRIKYLILDFKNINADNIDYSAAEGF
NRIKRFTQGKRIQLIISSIKEKDKIYSVFNMVRLLEDVELFDDLNSALEWCENEFLYQYM
QLHEKAKDRI----HKRISISKDSGSTYFSR------NRSDSGLSAADQQMLMSLPI-NT
PRNNQVLSVARKVFKNEAQTASKFKTH--NETDKPVLSLLLYSIRLFRPDVFSEDVSIRE
KEINFWGQLSPYFRRSLFPTGSTLVNSSNFFFVVESGVVRVTHDLPQGIVSETMSNRTCY
GKVVG--HRG-------TVTNLPKIIFKTETESIIWMIDDDTMSRIKKENLNLYTELLLL
VMTIREYRYKGLIGYTLVSA
>SAKL0F02926g
-----------MPNKKNRKSISEAITISLGLHSD---NIKQPSQANRRSSMNPE------
-----------NSSNYYLG-RSYV-GSFSSPS------FLQRESSA--------------
---DTGHILSL----HKDASKSIHESVKLHRQTAALSNNFDDSSDGKSDE---------I
DVAAS-------QEFQNEALQRELS---------------------------------LE
NGSYSNSNNNNNNNNQIAYSEDAI--TQENNGLNECTRLLSPTS-----------AAATD
LEYGTSPTNLSPPSSQYEQEQYVSLVADHSPSSAVYDQATGDGDNAFNTYHSLRQPVVRS
YYDYAKGWSIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFSHLGPTGLSMFYVST
ILSQLVYSCGFSAFGNGIGSEMIEITPFFHTMALSIMNSLP-GHD--DEIISTTIVCYAL
SSIFTGLAFFLLGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVCTRVSKFEYSWPF
LRELFYNTEVLGKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALFHFVVAIVPNLSL
NSLRESGWIFPMAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTFFGILHVPINVPA
LAMSIGMDKFDVDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAGSDSSWAGFLLAL
GTFVVMIIGPVIISFIPICIVGSLIFLLGYELIKEALFDTWGKLNRFEYITIVIIVFTMG
VFDFVLGIIVGILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQTKFLNKVGEQIH
VLKLQNLLFFGTIISIEEKIDGLLEISD-KDSSRQRIKYLILDFKNINADNIDYSAAEGF
NRIKRFTETKRIQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSALEWCENEFLLQYK
QIRTRTKAKLQAQKKQEKHLSKSL------------------------------LPI-NT
PRNNQIVTVAQKIF-PDEQNVTHLRTQ--YQKREPVLPLLLVALKKFRPQIMSYDKDVKQ
AEEDFWSKLCPYFVRKRFAPGSLLLHNNNLFFLVESGMLKITYDLHQGQFYETMSSKTCY
GRISG---NA-------EFTTNLYVNIKTETDCAVWIIDATNLANLKEKNLALYAELLLV
VMSINQYRSKELLGYSLVSS
>KLTH0F14674g
---------MGFSRPRNKHSLSEAISVSLGLQSQ----PGSETDTLSVPRGNPFSNGAD-
-----------GSPHYYLG-RSYV--ANLSPP------PLAIKERF--------------
---SGDPTSSS----RPEQSQSIHQSLSLRRQTAALSNEFDGT-----------------
------------FEFEDQLEDLAEN-----------------------------------
-GNTAVPDESVMAGSAISPTSSGP--EPSVLDNTDVSNLLLPPN------------TQRD
LEYGSIDEF---------DHQYVSL---QSQRAGSNSRAIDPN---------------AS
MRDKTLFTFRRLGNYVPAVILGLLLNILDALSYGMIIFPITEPLFSHLGPSGLSMFYMSS
VVSQLVYSCGFSAFGNAVGSEMIEITPFYHSMAASIMASMP-GEK--DRVLTTTIVCYAM
SSIMTGLVFFLLGRLKLGKIVGFFPRHILIGCIGGVGYFLVITGFEVTTRASKFEYSFEF
LSSLLTDPEILGKWGLPALMAVLLVVIQRACKNSLVLPTFYIAALLLFHFIVALIPSLSL
HSLRDSGWVFPATTTTEHWFDFYKLYNFKLVSWPLVLKQVPTMLALTFFGILHVPINVPA
LAMSIGLDKLDVDKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAGADDSLAGLMLAA
ATFGIMVIGPVIVAYIPVCIVGSLIFLLGYELLKEALVDTWGKLNNFEYATVVAIVFTMG
AFDFVLGIIVGILIACFSFLVDSTKLQTINGEFDGQVARSTVRRDYIQTQFLNKIGEQIH
VLKLQNLLFFGTIISIEEKIDKLLELSD-KDASKKRIKYLILDFKNINADNIDYSAAEGF
NRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVELFDDLNSALEWCENEFLRQFR
DLRNKTKLKAVRKQERQLSKGA--------------------------------LPF-NT
PRNNHFVSVAQKLF-TDEQSMPHLKTH--YKEKTPVLHLLLSALQRYRPEIMSPEKPVKE
TEEKMWSELGKFFFKRRLAAQSLLPHKNNIFLVVESGMVKVTYNLRQGQLYEILSGKTCY
GRITA--PNS-------SEVPISSVEIKMETDCALWILDEANLAKLKKENLALYTELLLV
TLCMNQDRLKELLGHCLVSS
>Kwal_55.21201
---------MVSNRPKNKPSISEAISVSLGLQSQ----SNSDQDSSYIPRANPFSHTGD-
-----------GSPHYYLG-RSYV--ANLSPP------PLARLPGG--------------
---LPGELPLSY---RPEQSQSIHQSVSLRRQTAALSNEFEDT-----------------
------------FEFEDQLAGVSED-----------------------------------
DGHSTTAEEPSMNGTLISPVSSVP---DTPIDINEPSNALLPPN------------AEHD
LEYGSIDGY---------EHQYVSL---QSRRSGANTHNIGPD---------------AS
LREKMMFTARRMVNYMPAVILGLLLNILDALSYGMIIFPITEPLFSHLGPTGMSMFYVSS
IISQLIYSGGFSAFGNAVGSEMIEITPFYHAMAASIVAGLP-GEK--DRVLSTTIVCYAL
SSIITGLVFFLLGRLRLGKIVGFFPRHILIGCIGGVGYFLLITGLEVTTRVAKFEYSFEF
LSSLFTNIEVLGKWGLPALMAVLLVVVQHAFGNSLVLPAFYIAALLLFHFIVALIPSLSL
DILRDSGWIFPATDSTEHWFDFYTLYNFKLVSWPMILKQIPTMLALTFFGILHVPINVPA
LAMSIGLDKLDVDKELIAHGYSNFLSGIMGSVQNYLVYTNSVLFIRAGGDDALAGLMLAA
ATFGIMIVGPVIVAYIPVCIVGSLIFLLGYELLKEALYDTWGKLNNFEYATVVAIVFTMG
AFDFVLGIIVGILIACFSFLVDSTKLQTVNGEFDGQVARSTVSRDYIQTQFLNKIGEQIH
VLKLQNLLFFGTILSIEEKIDKLLELSD-KDSSKKRIKYLILDFKNINADNIDYSAAEGF
NRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVELFDDLNSALEWCENEFLIQFK
DLRNKTKLKAGKKQDRRMSKVP--------------------------------LPF-NT
PRNNQFVSVAQKLF-TDEQSMTHLKSS--YRERPPVLPLLLSALQRFRPQIMSSDKSVKE
GEERLWSDLCKYFYKKRLAAHSLLLHKDNIFFVIETGMVKVTYNLRQGQLYETMSGKTCY
GRMSI--PNN-------NNNPISCVEVEMETDCSLWIIDDAGLAKLKRENLNLYTEVLLV
TLCINQDRLKELLGHCLVSS
>CAGL0I10626g
------MKSPQQRRKNSILSISESISVSLGLQYP-----EGNRDGSIDRLNESNSLNVNA
RPNTKNVGIPNNDTNTFLG-RSYV-SGILGSS---------LPQGG--------------
---ERNTLPVS----NKFGSRAIHEQNKLHRQTAAIAEEFDDGTIGE--SP--------S
SL----------KEYLNLLDEAQEE----------------------------------E
LDLRNRRDLDNDLITDNKTPVSINLKRATDPELEQQTVALLTPS---------SSNNDNY
GSVSPEENFLSATSNYEQESTYQSI---TVVPSAGFRQM--PT---------------ST
TAKAWMTLK-RVTNYMPAAILGLLLNILDALSYGMIIFPITEPIFAQLGPTGISMFYIST
IISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAISQALP-GRD--DEIITTTIFCYVI
SSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVTTRIAKFEYSIPF
LTKLFLDSSMLFKWLLPTILTIILIVTQKCFKNSLVLPSFYIITLILFHFVVAIAPNLSL
HQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPTMLALTFFGILHVPINVPA
LAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVLFIRAGADSAIAGYVLIV
LTIMVMVIGPVIISFIPICIVGSLIFLLGYELLVEAMIDPFGKVTTFEYATIGIIVLTMG
IFDFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKSTVYRDFTQTRFLSQIGEQIY
VLKLQNILFFGTIISIEEKIERLLEISD-NDVSKHRIKFLILDFKNINADNIDYSAAEGF
NRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELFNDLNSALEWCENEFLYQYK
ELREKARNKL---QRRSKNINAAIGNQLRRY----DQTNKNQGPTSSLMQNLMSLSN-NT
PRNYQLVSAAQQAFSNEQQISTEIDTK--LKIPDPLLKVLLFALKLYRPNIVSMDTEKRT
DEVEFWKQLCPYFTRKVFTANTTFLHNNNFFFLVDAGILKVIYNLPAGSVYETLSNGTCY
GKILS--KRD-------NENINQNLRVQVETDTILWIIDEKSMEIMKMDNIVLYTELVLL
ILAIRDTRFKELLGYTLVSA
>KNAG0B00860
----MGMSKAHRIKRPARQSISESISVSLGLQNN---------DARQSDNENPLQVL---
-----------PGESSYLG-RSYV-SGLWSPT--------QRNNKS--------------
---GYDLLPTSN---EQAYSKPIHKSQMLHRQTQAIGENFSDSNGDEGSEN--------K
DL----------NEYIDLVEHNERK--TANIDNVD------------------------Q
IGGLATGPQTTVPGNKTHPVTSPL--SDEYGIPDENSRLLLTPV-SSLSVAISDASSLTP
EDYNGRARSPLNGINSTYGSQIPTL---SSYSSAGMKIGP-PI---------------TS
KWDYISALSHDIVHYLPASILGLLLNILDALSYGMIIFPITEPIFSQLGPSGLSMFYIST
VISQFTYSSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTLGEERK--NEIITTTIFCYVI
SSMFTGLTFFTLGKLKLGKLVGFFPRHILIGCIGGVGYFLLITGIEVCTRIAKFEYSIPF
LLNLFTDEKTLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIVAIVPNLSL
TKLRNSGWIFPVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGILHVPINVPA
LAMSLQMDKYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAGYILIV
LTIIVMLIGPVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGIIILTMG
IFDFVLGIIVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGVGEQIY
VLKLQNLLFFGTIISIEEKIDKLLEISN-NDSSKRRIKYLILDFKNINTDNIDYSAAEGF
NRIRRFTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCENELLHWYN
ELRTKAKARLRKLNNTANSVVSRLPVSASKQMDSRAITSADQSGRAAIS-NLMSLPT-NT
PRNHQMLTVAQDVFKNDEQTVSSLRKQ--LKTKDPLLPLLLLTLKQYRPDIGSNDKLARD
KEIAIWSRLCPYFAKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMANRTCY
GKIID--SGTTVDDADTSNPDFSKLFITTETDSELWVIDAAAMGRLEREDPELFIQLALL
VMLIKDKRFKDLLGHALISA
>TDEL0D05530
---MPSTGNTGGPRNRGRHSISEAISVSLGLQNT-----NTPRDHHDGNHSNPYDSQND-
--------QFMSPRNNYLG-RSYV-SGFLSCS--------PYGSNS-----------L--
---ESDRLPI-----ARMRTKSIHAAKNLHRQTAKLCEDFNEPNV----ED--------N
NI----------QDYVSATEEPRPM-----------------------------------
-EISDAERMYDQEDELRNPVHVNT--EDRGDDIEDVYESLVTGA----------------
------------------HGGYRAI---PTSPGGGLRTS--SR---------------SA
LWRQFMSSSSKLVHYLPATILGLLLNVLDGLSYGMIIFPITEPIFSHLGPSGLSMFYVST
IISQVIYSSGFSNFPTGVGSEMIEVTPFFHSMALAIKDALP-GRD--DEILTTTIFCYVI
SSLVTGLTFYVLGKMKLGKIVGFFPRHILIGCIGGVGYFLVVTGLEVTTRVAKLEYTWPF
ISHMFTDVSTLVKWVLPVLLTVLLIVTQRHFQNSLVLPTFYIATLVAFHFVVAIIPNVSL
GKLRNMGWIFPVAASKDQWYDHYKLFQPHRVHWGLIAKQAPTMLALSFFGILHVPINVPA
LAISLQMDKYDVDKELIAHGYSNLLSGALGSIQNYLVYTNSLLFIRAGADSAMAGYLLAF
LTFIMMVIGPVIISYIPICIVGSLIFLLGYELLYEALIETRGKVTNFEYITICIIVLTMG
IFDFVLGVIVGILIACFSFLVDSTKLQTINGEYDGKIAKSTVYRDYVQSRFLDGIGEQIY
VLKLQSLLFFGTIISIEEKINKLLEISDDQKNSKRRIKCLILDLKNINADNIDYSAAEGF
NRIKRFTQSKHIQLIISSISETDHIYTAFSKVKLLDDVELFGDLNGALEWCENELLFKYK
ELRAKARDRL--QNKMQMANLAANNDTK-------AIDGVPKSHHMQ---NLMSLPF-NT
PRNDQMLSVAQRVFKNEQKTVDSLKVN--YKELPPVLPLLLFALKPYRPGILSEDTNVKN
SELELWSKLCPYFTRRRLASQSILLHNSDIFFVMETGILKIVYDLPQGIVYESLSNRTCY
GIVLN--PGT-------RPCSESKVTIKTETEVVLWVIDSSILARLKQENLSLYTELILL
IATVKEQRYRQILGYTLVSA
>KAFR0C01910
---MTSFNKSNDARASKRLSLSDSISRSLGLQDQ----ESNIAGTDNELS----------
-----------NSKSNYLS-RSYM-YGLL---------PSATPVEE-----------L--
---ETNTLPLS----NDLRNKSIHQSRILHKQTAAICEDFNES------DE--------G
SM----------KDYLDFIENTDRD-----------------------------------
------NINEHKESLPVTVVLSTP--ADEVEEQDESSRLLLTPS-------------SSN
AEVSSIAEGL--------RHHYSSI---ESTKDNNMPIEEQQD---------------NT
INEKLSTFFYNTLQYFPASVLGLLLNILDALSYGMIIFPISEPIFSHLGPTGMSMFYIST
IICQFIYSSGWSSFPSCIGSEMIEITPFFHTMAFAIMRSLP-GEENQDAIITTTIFCYVI
SSMFTGLTFLTLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGIEVTTRIAKFEYSLPL
IKELFTDTSMLWKWLTPTLLTVVLILTQKCFKRSLVLPSFYIATLILFHFIVAIIPRLSL
TQLREAGWIFSNTAPNSAWYDHYKLFDFHKVHWLLVFKQIPTMLALTFFGILHVPINVPA
LAMSVQMDKYDVDKELIAHGLSNLVSGMFGSIQNYLVYTNSVLFIRAGADSPFAGYLLIF
LTIVVMLIGPVIISFIPICIVGSLIFLLGYELLVEALLDTWDKLTTFEYVTVVVIVLTMG
IVDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTVNRDLIQSKFLNGIGDQIY
VLKLQNLLFFGTIISIEEKIDKLLEMSD-RNSSKRQIKYLILDFRNINADNIDYSAAEGF
NRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVELFNDLNGALEWCENEFLYQYK
MIRERIKIKNVKTATHSSDGNLSKPSA-------------------------MTLSI-NT
PRNYQIYSVAQNIFKNEEQTVDRLKNR--FQDQTPVLPLLLFALKQYRPDIVSVDKVKKG
KEIEFWSQLAPYFSKKRIASQSILYHGNNIFFLVEIGVLKVTFDLPQGKVYETMSKRACY
GKIMGKIPVS-----EADAPSSQAMIIKTEADTVIWIIDSSALKKMKDENIELYLELVLL
VMTIKDIRFKSLLGHALVST
>ZYRO0C07986g
------MSNGVDRPSRNRQSISGAISVSLGLNRQVHRNSDGEFTNYNNTNNNGGRINQND
SSSIEIVSPPFYNSNNYAG-RSYLGGGFLSAS------PKMNLQQR-----------ND-
---DSSVLPI-----DRSRSKSIHGSQIIHRQTAELSNNFSDDTTGM------------E
EV----------RNRYDAMEDENSS-----------------------------------
--------------------------LHHYMTHQDYQTLP--------------------
---GGTDEDW--------TNNNNSQ---TARASGSS------------------------
----IVQFGQDVLHYFPSAVLGLLLNILDGLSYGMIIFPITEPIFSHLGSTGLSMFYIST
IISQCLYSGGLSSFTSGIGSEMIEVTPFFHTMAFAIRDAIP-GQD--DDIITTTIFCYAI
SSVVTGITFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGLGVTTRLAKIEYTWEF
LKKLFLDTDILWKWLLPVVLTILLVNTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISL
DQLRDLGWIFPAATSKDRWFDHYKLFDWHKVHWNLVLAQIPTMLALTFFGILHVPINVPA
LAISLHMDKFDVDKELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAI
LTFAVMVIGPVIVSFIPICIVGSLIFLLGYELLVEALLDTRGKVTNFEYITIVIIVLTMG
IYDFVLGVIVGILIACFSFLVDSTKLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIY
VLKLQNVLFFGTIISIEEKIDKLLEITDSKSSSKRRIKYLILDFKNINADNIDYSAAEGF
NRIKRFTQTKRIKLIISSIKERDHIYNVFSNVGLLDDVELFNDLNGALEWCENEFLGEYK
KLRDRAREKM----QHSYNVTSAIEAAAAKKVPTDNNQISKKNLSLLNFRNLSSLPM-NT
PRNHQMLSVAQNMF-NDEEDVDALEDESCNDGQQPVLPLLLFALKSYRKNITSTDPHLRE
RETQLWSQLVPYFVKRRLTTQSILLHNQDFFFVVESGLLKIALDLPQGVVYETMSNRTCC
GNIVG--SDY-------KSSEEHKVTIVTETDTCLWLIDVDGLQKLRAENLQLYTELVLL
CLLIKSRRFEQLLGYTLVSA
>Suva_7.413
-------MGRNIRRRRSNSSLSEAITVSLGINYQ----DSSKNKIHRASA----------
-----------STMSPPLC-RSYM-SGFFTGG------SSPMNYNM--------------
---SDPKLPFS----NKQHPKVIHGSENLHRQTAQLSNEFCSSSVEE--NS--------P
TI----------KDYMDIIDSDDRK-----------------------------------
------------DDQSMRTIEENI--DEEYA--DEYSRLLLSPA----------SSNVDD
ERNRALQGSPTSDLEDGHGGGYQSV-----HPSHDLRFGP------------------RS
VWQWFTSFPSKFAQYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYIST
IISQSVYSGGWSSFPSGVGSEMIEITPFYHTMALGIKEALV-GSD--DEIITTTIFCYVI
SSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPF
VSGLFTNYDTLAKWLLPVLLTVVLIGTQRCFKNSLVLPTFYILTLVLFHFIVAIIPTLSL
DTLRDSGWIFPIASSDSKWYDHYKLFNIHKVHWTLVLQQIPTMMALTFFGILHVPINVPA
LAMSLQMDKYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLVA
LTVCIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWSKLNRFEYLTVVIIVFTMG
IFDFVLGIIVGILIACFSFLVDSTKLQTVNGEYNGNVAKSTVYRDYVQTKFLDGIGEQIY
VLKLQNVLFFGTIISIEEKIERLLEISN-KDSTKRRIKYLILDFKNINADNIDYSAAEGF
NRIKRFTETKRIKLIISSIKERDHIYNAFNNVGLLNDVELFADLNGALEWCENEFLFQYK
QLREKAKKRL--EERKQNNVVSAIMAATQNKKIDRSGIDLNKGGNRDQARHLMSLPT-NT
PRNHQMLSVAQNVFANDEQAVKNLKKE--YKEDEPVLPILLFALKQYRPDIVSEVQKVRE
KEIKFWAQLCPYFSRRRLASQSLLLHADNVFFLIETGMLKAVYELPQGSLYEIMSNGTCF
GKIIA--PGN-------TMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVTLM
IMCIKDTRFKELLGYTLVSA
>Skud_7.436
-------MGRTIRRRRSNSSLSEAISVSLGINQD-----SSKNKMHRASV----------
-----------SAMSPPLC-RSYM-SGFFTGG------SSPMVKNM--------------
---SDSKLPFS----NKQHPTVIHGSENLHRQTAQLSNEFCSSSVEE--NS--------P
TI----------KDYMDIIDSDDRK-----------------------------------
------------DDQSMRTIVENI--DEEYS--DEYSRLLLSPA----------SSNVDD
ERNRALQSGPISELEDDYGGGYQSL-----RPSHNLRFR---P---------------RN
IWQWCTSFPFKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYIST
IISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAVKDALE-GND--DEIITTTIFCYVI
SSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPF
FSGLFTNYDTLAKWLLPVLLTVILIGTQRYFKNSLVLPTFYILTLVLFHFIVAIIPTLSL
DTLREAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPA
LAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIA
LTICVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMG
VFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIY
VLKLQNVLFFGTIISIEEKIEKLLQISN-KDAKKRRIKYLILDFKNINADNIDYSAAEGF
NRIKRFTGTKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYK
QLREKAKKRL--EERKQSSVASAIMAATQNKKIDGLGNGLSTGENRDHARNLMSLPT-NT
PRNYQMLSVAQNVFVNDEQAVKNFKME--YKNDEPILPILLFALKQYRPDIISEIQTVRE
KEIKFWAQLCPYFTRRRLASQSLLLHADNIFFLVETGMLKATYELPQGTLYEIFSNGTCF
GKIIA--PGN-------AMPREQKLTIETETDSVLWVIDSSSLKKMKEENLALYVEVTLM
VMCIKDTRFKELLGYTLVSA
>Smik_6.221
-------MGRTIRRRRSNSSLSEAISVSLGINQD-----SSINKMHRASV----------
-----------SAMSPPLC-RSYM-SGFFTGG------NSPMINSM--------------
---SDSKLPLS----NKQHPKVIHGSENLHRQTAQLSNEFCSSSVEE--NS--------P
TI----------KDYMDIIDSGDRK-----------------------------------
------------DDQSMRTIEEDI--DEEYS--DEYSRLLLSPA----------SSNIND
DRNRGLQNGLTSELEDDYEGGYQSL-----RSSHNLRSR---P---------------RN
FRRLCTSFPSKFIHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYIST
IISQAVYSGGCSSFPSGIGSEMIEITPFYHTMALAVKEALA-GDD--DEIITTTIFCYVI
SSMLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPF
FLGLFTNYDTLAKWLLPVILTVILIGTQRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSL
DTLRAAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPA
LAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAGFLLIA
LTICIMMIGPVIISFIPICIVGSLIFLLGYELLVEALIDTWNKLNRFEYLTVVIIVFTMG
IFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDYVQTKFLDGIGEQIY
VLKLQNLLFFGTILSIEEKIEKLLQISN-KDATKRRIKYLILDFKNINADNIDYSAAEGF
NRIKRFTETKKIKLIISSIRERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYK
QLRIKAKERL--EERKQNNIVSAVMAATQNKNINALGNGLNKGNNIDPVRNLMSLPT-NT
PRNYQMLSVAQNVFVNDEQAVKNFKKE--YKDDEPVLPILLFALKQYRPDIISEIQKVRE
KEIKFWAQLCPYFTRRRLASQSLLLHADNVFFLVETGMLKATYELPQGTLYEIFSNGTCF
GKIIA--PGN-------AMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVALM
VMCIKDTRFKELLGYTLVSA
>YGR125W
-------MGRTIRRRRSNSSLSEAISVSLGINQD-----SSVNKMHRASV----------
-----------SAMSPPLC-RSYM-SGFFTGG------NSPMINNL--------------
---SDSKLPIS----NKQHPKVIHGSENLHRQTAQLSNEFCSSSVEE--NS--------P
TI----------KDYMDIIGNGDRK-----------------------------------
------------DDQSMRTIEENI--DEEYS--DEYSRLLLSPA----------SSNVDD
DRNRGLQNSSLPELEDGYAGGYQSL-----RPSHNLRFR---P---------------RN
LWHMCTSFPSKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGISMFYIST
IISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAIKEALA-GND--DEIITTTIFCYVI
SSMLTGVVFYALGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFEYSWPF
FSGLFTDYDTLAKWLLPVLLTVVLIGTQRYFKNSLVLPSFYILTLVLFHFIVAIIPTLSL
DALRQAGWIFPIANSDSKWYDHYRLFNVHKVHWSLVLQQIPTMMALTFFGILHVPINVPA
LAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSPFAGFLLIA
LTICIMIIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNRFEYLTVVIIVFTMG
IFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVARSTVYRDYVQTKFLDGIGEQIY
VLKLQNLLFFGTIISIEEKIERLLQISN-KDATKRRIKYLILDFKNINADNIDYSAAEGF
NRIKRFTETKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSALEWCENEFLFQYK
QLRKKAKERL--EEGKQNNVVSAVIAATKNKKIDTIGNGLNRGSNGDTARNLMSLPT-NT
PRNYQILSVAQNVFVNDEQAVKNFKKE--YKDDEPVLPILLFALKQYRPDIISEVQKVRE
KEIKFWAQLCPYFTRRRLASQSHLLHADNIFFLVETGMLKATYELPQGTLYEIFSNGTCF
GKIIA--PGN-------AMPREQKLTIETETDSVLWVIDSSSLNKLKEDNLALYVEVALM
VMCIKDTRFKELLGYTLVSA
>NDAI0G00990
----------MRRQKNNRHSISDTISVSLGLQNQ-------DPQILQQPNGGPTVTLGN-
----------MSDTSNYLG-RSYV-SGFLSAS------PAINHDN---------------
---NNNTLPIA----NQHLNKSIHASQNLHRQTAAISEDFNNDPTFE--DD--------I
NM----------KEYISNLEDDATG----------------------------------N
NGKRYTAYYIDNEDRIDNILTEEAEPVTDFYPQDENSRLLLSPI-------PSDSLLAGE
NLLPSISEQEQETAQRRRTSAYQSI---RHRNSESTEYS---S---------------IP
TWRKYIATPSEIIQYLPASILGLLLTILDALSYGMIIFPITEPIFSHLGPTGISMFYIST
IISQSIFSGGWSSFPCGIGSEMIEVTPFFHTMAFAIKDALPEGSN--DDIITTTLFCYVI
SSMLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLIITGIEVSTRVAKFQYTIPF
ITHLFTDVVTLWQWLLPTLLTVILIIAQKCAQNSLVLPSFYILTLILFHFMVAIIPSLSL
NQLRDSGWIFPQAATDSKWYDHYKLFNLHKVHWTLILKQIPTMLALTFFGILHVPINVPA
LAMSLQMDRYDVDKELIAHGVSNFVSGMFGSIQNYLVYTNSVLFIRAGADSALAGHILIV
LTIIIMIIGPVIISFIPICIVGSLIFLLGYELLVEALVDPLGKISKFEYITIVIIVFTMG
IFDFVLGVIVGILIACFSFLIDSTKLQTINGEFDGTVAKSTVYRDLIQTKFLNGIGEQIY
VLKLQNLLFFGTIISIEEKIDKLLEISD-MDSSKHRIKYLILDFKNINADNIDYSAAEGF
NRIKRFTQTKRIRLIISSIRERDHIYNAFNNVGLLEGVELFNDLNSALEWCENEFLFKYK
TLREKTRQKRKNKIDINLAITNGNPTEE-------------RNMHLEIPRNIMSLPM-NT
PRNNQMLSVAQNVFRNEEQAAKALKQQ--FKNEPSVLPLLLFVLKQYRPRIVSNDKSIEE
KEIKFWSQLCPYLSERFLVAQSTLKHNNNFFFIVESGILKATFTLPSGTLYETMSNRTCY
GKILG--SNN-----ETTVLNEQDLTIKTETDCNLWVIDMDALTRMRAENLELYIELVLL
IMSIRDTRFKELLGYTLVSA
>NCAS0E00950
---MSHRNSIDFKKKNKQQSISGSISVSLGLQQE-----EEPRDDYFDDEN---------
-----------VNNNNYMG-RSYV-SGFLSVS------PALMGSMK--------------
--QDEESLPMAYNGGQRLFNRPIHASEKLHKQTAAISEDFEDDE-----DD--------T
RI----------KDYITLFQGEDNG------------------------------LMADK
NDSLDQRLGLGQDEEAEEDFIEPV---AEAADVDESSRLLISPL-------SSNINPNID
DLLPTVTGED--------VSSYQSI---YRTATPSLSRN---S---------------ET
IWQNIADFPYQFIHYLPAAVLGLLLNILDALSYGMIIFPITEPIFSHLGPTGLSMFYIST
IISQTIYSSGWSSFPSGIGSEMIEVTPFFHTMALAIKETLP-GRD--DEIITTTIFCYVI
SSMLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLLVTGIEVTTRVAKFEYSIPF
LASLFSDWATLWKWLLPVLLTVILIVTQRCFKNSLVLPSFYILTLILFHFIVAIIPSLTL
NQLRDSGWIFPIAISNSKWYDHYKLFDFKKVHWTLVFKQIPTMLALTFFGILHVPINVPA
LAMSLHLDKYDVDKELIAHGLSNFISGAVGSIQNYLVYTNSVLFIRAGADSAMAGYILII
LTAIVMFIGPVIISFIPICIVGSLIFLLGYELLVEALWDPWGKISNFEYITIVIIVLTMG
IFDFVLGIIVGILIACFSFLIDSTKLQTINGEYDGTVAKSTVYRDLIQTKFLNGIGEQIY
VLKLQNLLFFGTIISIEEKIDELLEICH-KDSSRLRIKYLILDFKNINADNIDYSAAEGF
NRIKRFTQTKKIQLLISSIKERDHIYKAFDNVGLLKGVELFNDLNSALEWCENEFLFKYK
QLRDKAKSRL--HRKQIIDINASIGSQKYQ-----FTAGNDKKSNLDIPRNLMSLPI-NT
PRNHQILSVAQNVFQNEEQTVKNLKTE--LKDQAPFLPLLLFTLKQYRPGIISTDKTVKE
NEIKFWSQLCPYFVKLPLASQSTLIHNNNIFFIVETGILKATFNLPQGNIYETMSNRTCY
GKITG--QHN--------ESTLKTLTIRAEIDSILWVIDSGSLIKMRAENAELFTELTLL
IMAVKDNRFKELLGYTLVSA