MUSCLE (3.8) multiple sequence alignment

Ecym_1244          MCGIFACYRRDGIESFKPVALQLSKRIRHRGPDWSGNVVKNDTIFVHERLAIVGLDTGAQ
ZYRO0B04136g       MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ
AFR303W            MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ
TBLA0C04430        MCGIFAAYKHPEVNAFKPRALQLTKRIRHRGPDWSGNVVKNTTLFAHERLAIVGLDSGAQ
KAFR0G03670        MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ
KNAG0A07920        MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ
TDEL0D05520        MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ
Suva_16.474        MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ
Skud_16.439        MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ
Smik_16.396        MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ
YPR145W            MCGIFAAFRHEDVHRYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGVESGAQ
Suva_7.410         MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ
YGR124W            MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ
Smik_6.220         MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ
Skud_7.435         MCGIFAAFKHEDINSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ
KLTH0F14630g       MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ
Kwal_55.21187      MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ
NDAI0B05810        MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ
NCAS0F03510        MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ
KLLA0B10868g       MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ
SAKL0F02970g       MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ
TPHA0D04200        MCGIFTVYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTIMAHERLAIVGLDSGAQ
CAGL0I10648g       MCGIFAAYKHQDVHAFKPKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ
Kpol_480.19        MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ
                   *****: ...     :.  **.* *.:**********   * *::.****:***:::*:*

Ecym_1244          PIVSDDGNYVLCVNGEIYNHIHLRDICADYPFSTLSDCEPIIPLFKKYGVETPNYLDGMF
ZYRO0B04136g       PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF
AFR303W            PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF
TBLA0C04430        PITSPCGNYMLTVNGEIYNHIQLREETTDYKYKTLGDCEPIIPMYLKYDVDAPNHLDGMF
KAFR0G03670        PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF
KNAG0A07920        PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF
TDEL0D05520        PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF
Suva_16.474        PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF
Skud_16.439        PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF
Smik_16.396        PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF
YPR145W            PITSSDGEYMLCVNGEIYNHIQLREECADYEFGTLSDCEPIIPMYLKHDIDAPKYLDGMF
Suva_7.410         PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF
YGR124W            PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF
Smik_6.220         PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF
Skud_7.435         PIASADGEYMLGVNGEIYNHIQLREKCSGYKFQTFSDCEPIIPLYLEHDIDAPKHLDGMF
KLTH0F14630g       PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF
Kwal_55.21187      PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF
NDAI0B05810        PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF
NCAS0F03510        PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF
KLLA0B10868g       PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF
SAKL0F02970g       PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF
TPHA0D04200        PITSQDGDHILCVNGEIYNHIQIREQFPDYQFKTLSDCEPIIPLYMKYGAEAPKHLDGMF
CAGL0I10648g       PITSEDGDYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPAYLEHDIDAPKYLDGMF
Kpol_480.19        PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF
                   *: *   .: * ****:**** :*:  . * : ::.******* :   . ::*: *****

Ecym_1244          AWCLYDAKDDRIVAARDPIGVTTLYMGKCSKSPRTRYFASELKCLVEECDEIISFPPGHV
ZYRO0B04136g       AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV
AFR303W            AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV
TBLA0C04430        AFVLYDSQKDRVIAARDPVGITTLYMGRNSKTPKTVYFASELKCLVDDCDSIIAFPPGHV
KAFR0G03670        AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI
KNAG0A07920        AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV
TDEL0D05520        AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI
Suva_16.474        AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV
Skud_16.439        AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV
Smik_16.396        AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV
YPR145W            AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV
Suva_7.410         AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV
YGR124W            AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV
Smik_6.220         AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV
Skud_7.435         AFCLYDAKKDRVVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIISFPPGHV
KLTH0F14630g       AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV
Kwal_55.21187      AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV
NDAI0B05810        AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV
NCAS0F03510        AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV
KLLA0B10868g       AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV
SAKL0F02970g       AWCLYDAKKDRIIAARDPIGITTLYMGRSSSSPSTVFFASELKCLVDDCDEITAFPPGHV
TPHA0D04200        AWTLYDAKQDRIIAARDPIGITTLYMGRSSKSPKTVYFASELKCLTDDCDSIVAFPPGHV
CAGL0I10648g       AWCLYDAKQDRIVAARDPVGITTLYMGRCSSSPKTVFFASELKCLTDDCDEITAFPPGHV
Kpol_480.19        AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV
                   *: :** : **::*****:*:.*****. *  * : :*:****** : ** * :*****:

Ecym_1244          YDSDTDQITRYFKPSWLVDSITPTKPVDYKKLRGGLEKAVRKRLMTEVPYGVLLSGGLDS
ZYRO0B04136g       YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYGVLLSGGLDS
AFR303W            YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYGVLLSGGLDS
TBLA0C04430        YDSETDKIERYFKPNWIDESIIPTTPVDLKQVRETLERAVRKRLMAEVPYGVLLSGGLDS
KAFR0G03670        YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS
KNAG0A07920        YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYGVLLSGGLDS
TDEL0D05520        YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS
Suva_16.474        YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS
Skud_16.439        YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS
Smik_16.396        YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS
YPR145W            YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS
Suva_7.410         YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS
YGR124W            YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS
Smik_6.220         YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS
Skud_7.435         YDSETDKITRYFTPNWLDEKRIPSVPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS
KLTH0F14630g       YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS
Kwal_55.21187      YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYGVLLSGGLDS
NDAI0B05810        YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFGVLLSGGLDS
NCAS0F03510        YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYGVLLSGGLDS
KLLA0B10868g       YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYGVLLSGGLDS
SAKL0F02970g       YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYGVLLSGGLDS
TPHA0D04200        YDSVTDQITRYYTPDWIDENRIANQPLDLMKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS
CAGL0I10648g       YDSKTDQITRYFTPDWIDESRIPTTPVNFKDIRESLEKAVRKRLMAEVPYGVLLSGGLDS
Kpol_480.19        YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYGVLLSGGLDS
                   *** :*:: **:.*.*: :   .   :.   :*  ** :******:***:**********

Ecym_1244          SLIAAIAARETEKANKEMDVVKYD-SQV------R---NLVGVDDELHLHASGWSKLHSF
ZYRO0B04136g       SLIASIAARETERANEELDPVNYD-SEE------K---HLAGIDAQGNLHTGGWSRLHSF
AFR303W            SLIASIAARETERANREAGDVY---ADG------K---HLAGMDDRGLLHTGGWSRLHSF
TBLA0C04430        SLIASIAARETEKVMDETNTIDYEKQSDDAADASK---KLTGLDDSGNLQTQSWSKLHSF
KAFR0G03670        SLIASIAARETEAANRELDASQYA-EEG------S---HLAGIDDEGHLRTSGWSRLHSF
KNAG0A07920        SLIAAIAARETEKANKELDPRKYDEQEE------AEGHHLAGIDDEGNLLSATWSRLHSF
TDEL0D05520        SLIASIAARETEKANAEIDAQKYD-SED------K---HLAGIDDSGNLHSAGWSRLHSF
Suva_16.474        SLIAAIAARETAKATNDVEPSTYD-NKA------R---HLAGVDDEGNLHTAGWTSLHSF
Skud_16.439        SLIASIAARETANATNDVEPSTYD-SKA------R---HLAGVDDDGNLHTAGWTSLHSF
Smik_16.396        SLIASIAARETANATNDVDPSTYD-SKA------R---HLAGVDDDGKLHTAGWTSLHSF
YPR145W            SLIASIAARETAKATNDVEPSTYD-SKA------R---HLAGIDDDGKLHTAGWTSLHSF
Suva_7.410         SLIAAIAARETETANVEANEEAS--AEK------S---KLAGIDDQGHLHTSGWSRLHSF
YGR124W            SLIAAIAARETEKANADANEDNN--VDE------K---QLAGIDDQGHLHTSGWSRLHSF
Smik_6.220         SLIAAIAARETEKANADVNEESS--VDE------K---QLAGIDDQGHLHTSGWSRLHSF
Skud_7.435         SLIAAIAARETEKANADADGDAS--VNN------K---QLAGIDDQGHLHTSGWSRLHSF
KLTH0F14630g       SLIASIAARETEKANSQMDPVKYD-SED------K---HLAGVDDAGNLRSAGWSHLHSF
Kwal_55.21187      SLIAAIAARETEKANTEMNPVEYD-SED------K---HLAGVDDSGKLHSAGWSRLHSF
NDAI0B05810        SLIASIAARETEKANAQATLDNENANDE------TSKAHLTGVDDEGHLHNGGWSKLHSF
NCAS0F03510        SLIASIAARETEKAMQDVDVEDENGEHH------K---HLTGVDDEGHLHTGGWSRLHSF
KLLA0B10868g       SLIAAIAARETEKTNAELDPVVYD-SDP------H---QLAGLDEQGHLHAAGWSRLHSF
SAKL0F02970g       SLIAAIAARETEKANKDLDPVAYD-DED------K---HLAGVDDKGNLHAAGWSRLHSF
TPHA0D04200        SLIASIAARETEKAMKTASSDSLS-SSV------N---QLTGIDDNGNLRSSGWSRLHSF
CAGL0I10648g       SLIASIAARETEKANEENDAADNDASAS------K---QLAGIDNQGHLHTAGWSRLHSF
Kpol_480.19        SLIASIAARETEKAMKEMDTTAYD-SED------K---HLTGIDDQGNLHTAGWSRLHSF
                   ****:******  .                        :*.*:*    *    *: ****

Ecym_1244          AIGLPNAPDLQAARKVAKFIGSIHHEHTFTIQEGLDALDDVIHHLETFDVTTIRASTPMF
ZYRO0B04136g       AIGLPGAPDLLAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
AFR303W            AIGLPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMF
TBLA0C04430        AIGLPGAPDLKAARKVANFIGSIHHEHNFTIQEGLDALDDVIYHLETYDVTTIRASTPMF
KAFR0G03670        AIGLPGAPDLIAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMF
KNAG0A07920        AIGLPGAPDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
TDEL0D05520        AIGLPGAPDLKAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMF
Suva_16.474        AIGLPNAPDLQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
Skud_16.439        AIGLPNAPDLQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
Smik_16.396        AIGLPNAPDLQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
YPR145W            AIGLPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
Suva_7.410         AVGLPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
YGR124W            AIGLPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
Smik_6.220         AIGLPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
Skud_7.435         AVGLPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
KLTH0F14630g       AIGLPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMF
Kwal_55.21187      AVGLPNAPDLEAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
NDAI0B05810        AIGLPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
NCAS0F03510        AIGLPNAPDLQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
KLLA0B10868g       AVGLPNAPDLQAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
SAKL0F02970g       AIGLPNAPDLQAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
TPHA0D04200        AIGLPGAPDLIAAKKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
CAGL0I10648g       AIGLPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
Kpol_480.19        AIGLPNAPDLLAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
                   *:***.**** ** ***.**.* ****.**:***:***.*** ****:************

Ecym_1244          LLSRKIKAQGIKMVLSGEGSDEIFGGYLYFAQAPSAKDFHNESVERVKNLHLADCLRANK
ZYRO0B04136g       LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANK
AFR303W            LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANK
TBLA0C04430        LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADNLRANK
KAFR0G03670        LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANK
KNAG0A07920        LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANK
TDEL0D05520        LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANK
Suva_16.474        LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANK
Skud_16.439        LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANK
Smik_16.396        LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANK
YPR145W            LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANK
Suva_7.410         LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANK
YGR124W            LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANK
Smik_6.220         LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANK
Skud_7.435         LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANK
KLTH0F14630g       LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANK
Kwal_55.21187      LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANK
NDAI0B05810        LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANK
NCAS0F03510        LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANK
KLLA0B10868g       LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANK
SAKL0F02970g       LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANK
TPHA0D04200        LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANK
CAGL0I10648g       LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSATEFHIESVKRVKNLHLADCLRANK
Kpol_480.19        LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANK
                   **********:***********************.. :*: * ..**:****:* *****

Ecym_1244          STMAWGLEARVPFLDRDFLELCMNIDPEEKMIKPKEGKIEKYILRKAFDTSDEPDVEPYL
ZYRO0B04136g       STMAWGLEARVPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYL
AFR303W            STMAWGLEARVPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYL
TBLA0C04430        STMAWGLEARVPFLDRDFLNLCMNIDPNDKMIKPKEGKIEKYLLRKAFDTSDEPDVKPYL
KAFR0G03670        STMAWGLEARVPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYL
KNAG0A07920        STMAWGLEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYL
TDEL0D05520        STMAWGLEARVPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYL
Suva_16.474        STMAWGLEARVPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYL
Skud_16.439        STMAWGLEARVPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYL
Smik_16.396        STMAWGLEARVPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYL
YPR145W            STMAWGLEARVPFLDREFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYL
Suva_7.410         STLAWGLEARVPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYL
YGR124W            STMAWGLEARVPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYL
Smik_6.220         STMAWGLEARVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYL
Skud_7.435         STMAWGLEARVPFLDRDFLQLCMNIDPKDKMINPKEGRIEKYILRKAFDTTDEPEVKPYL
KLTH0F14630g       STMAWGLEARVPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYL
Kwal_55.21187      STMAWGLEARVPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYL
NDAI0B05810        STMAWGLEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYL
NCAS0F03510        STMAWGLEARVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYL
KLLA0B10868g       STMAWGLEARVPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYL
SAKL0F02970g       STMAWGLEARVPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYL
TPHA0D04200        STMAWGLEARVPFLDREFLDLCMNIDPSEKMINQKEGRIEKYILRKAFDTTDEPNEKPYL
CAGL0I10648g       STMAWGLEARVPFLDKEFLQLCMNIDPKDKMIDQSAGRIEKYILRKAFDTSDEPDVKPYL
Kpol_480.19        STMSWGLEARVPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYL
                   **::***********.:**::**::** :*:*    *.:***:******* .:*  .***

Ecym_1244          PQEILWRQKEQFSDGVGYSWIDALKDAAENAISDEQFAQPKPEWGDDIPSTKEAYWYRMK
ZYRO0B04136g       PEDILWRQKEQFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLK
AFR303W            PEEILWRQKEQFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLK
TBLA0C04430        PEEILWRQKEQFSDGVGYSWIDSLKDTAERVISDEMFANPKDHWGSDIPTTKEAYWYRLK
KAFR0G03670        PDEILWRQKEQFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLK
KNAG0A07920        PEEILWRQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLK
TDEL0D05520        PEEILWRQKEQFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLK
Suva_16.474        PEEILWRQKEQFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLK
Skud_16.439        PEEILWRQKEQFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLK
Smik_16.396        PEEILWRQKEQFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLK
YPR145W            PEEILWRQKEQFSDGVGYSWIDGLKDTAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLK
Suva_7.410         PEEILWRQKEQFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLK
YGR124W            PEEILWRQKEQFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLK
Smik_6.220         PEEILWRQKEQFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLK
Skud_7.435         PEEILWRQKEQFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGNDIPTTKEAYWYRLK
KLTH0F14630g       PEEILWRQKEQFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLK
Kwal_55.21187      PEEILWRQKEQFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLK
NDAI0B05810        PEEILWRQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLK
NCAS0F03510        PQEILWRQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLK
KLLA0B10868g       PEEILWRQKEQFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLK
SAKL0F02970g       PEEILWRQKEQFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLK
TPHA0D04200        PDEILWRQKEQFSDGVGYSWIDGLKDTAERVISDELFENPREHWGSDIPTTKEAYWYRLK
CAGL0I10648g       PEEILWRQKEQFSDGVGYSWIDGLKDTAERVISDTMFSNPKIEWGEDIPTTKEAYWYRLK
Kpol_480.19        PEEILWRQKEQFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLK
                   *::******************* *.* ** .***  :  *.  ** * *:****:***:*

Ecym_1244          FDALFPQPTAASTVMRWVPKAEWGCSEDPSGRFAKIHEKHISK-
ZYRO0B04136g       FDKFFP-KSAANTVMRWIPKADWGCHGDPSGRFAKIHEQHIDN-
AFR303W            FDALFPQPTAAATVMRWVPKADWGCAEDPSGRYAKIHDQHISS-
TBLA0C04430        FDALFPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEQHIDG-
KAFR0G03670        FDALFPQPTAAETVMRWIPKADWGCAEDPSGRYAQIHEKHIQ--
KNAG0A07920        FDALFPQPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVEDA
TDEL0D05520        FDALFPQKTAADTVMRWVPKADWGCAEDPSGRFAQIHDQHVKN-
Suva_16.474        FDGLFPQKTVADTVMRWVPKADWGCAEDPSGRYAQIHEKHID--
Skud_16.439        FDALFPQKTVADTVMRWVPKADWGCAEDPSGRYAQIHEKHIE--
Smik_16.396        FDALFPQKTVADTVMRWIPKADWGCAEDPSGRYAQIHEKHID--
YPR145W            FDALFPQKTVADTVMRWIPKADWGCAEDPSGRYAQIHEKHIE--
Suva_7.410         FDAWFPQKTAADTVMRWVPKADWGCAEDPSGRYAQIHEKHVNA-
YGR124W            FDAWFPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVSA-
Smik_6.220         FDAWFPQKTAANTVMRWVPKADWGCAEDPSGRYAKIHEKHVGA-
Skud_7.435         FDAWFPQKTAADTVMRWVPKADWGCAEDPSGRYAKIHEKHVSA-
KLTH0F14630g       FDALFPQKTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHIDK-
Kwal_55.21187      FDALFPQKTAASTVMRWIPKADWGCAEDPSGRYAKIHDQHISK-
NDAI0B05810        FDALYPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVNA-
NCAS0F03510        FDALYPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVDGN
KLLA0B10868g       FDALFPQKTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHVDKK
SAKL0F02970g       FDALFPQKTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHIQN-
TPHA0D04200        FDALFPQPTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHIGAK
CAGL0I10648g       FDALFPQKTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHVTA-
Kpol_480.19        FDALFPQKTAAETVMRWIPKADWGCAEDPSGRYAKIHEQHIGDK
                   **  :*  :.* *****:***:***  *****:*:**::*:   

FASTA FORMAT for MUSCLE Version 3.6

>Ecym_1244
MCGIFACYRRDGIESFKPVALQLSKRIRHRGPDWSGNVVKNDTIFVHERLAIVGLDTGAQ
PIVSDDGNYVLCVNGEIYNHIHLRDICADYPFSTLSDCEPIIPLFKKYGVETPNYLDGMF
AWCLYDAKDDRIVAARDPIGVTTLYMGKCSKSPRTRYFASELKCLVEECDEIISFPPGHV
YDSDTDQITRYFKPSWLVDSITPTKPVDYKKLRGGLEKAVRKRLMTEVPYGVLLSGGLDS
SLIAAIAARETEKANKEMDVVKYD-SQV------R---NLVGVDDELHLHASGWSKLHSF
AIGLPNAPDLQAARKVAKFIGSIHHEHTFTIQEGLDALDDVIHHLETFDVTTIRASTPMF
LLSRKIKAQGIKMVLSGEGSDEIFGGYLYFAQAPSAKDFHNESVERVKNLHLADCLRANK
STMAWGLEARVPFLDRDFLELCMNIDPEEKMIKPKEGKIEKYILRKAFDTSDEPDVEPYL
PQEILWRQKEQFSDGVGYSWIDALKDAAENAISDEQFAQPKPEWGDDIPSTKEAYWYRMK
FDALFPQPTAASTVMRWVPKAEWGCSEDPSGRFAKIHEKHISK-
>ZYRO0B04136g
MCGIFAAFRHTDVQEYRPHALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLESGSQ
PIKSPCGNYTLCVNGEIYNHIQLREECSDYPFQSLSDCEPIIPLYLKYGLDAPKKLDGMF
AWCLYDSKEDRIVAARDPIGITTLYMGKSSKSPKTRFFASELKCLIDDCDEIVAFPPGHV
YDSKSDQITRYFNPQWLDESYMPSTPLDYKVLRHSLEKSVRKRLMAEVPYGVLLSGGLDS
SLIASIAARETERANEELDPVNYD-SEE------K---HLAGIDAQGNLHTGGWSRLHSF
AIGLPGAPDLLAARKVAKFIGSLHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAKEFQAECASRVKNLHLADCLRANK
STMAWGLEARVPFLDRDFLNLCMELDPNEKMIKPEEGRIEKYILRKAFDTTDEPNVKPYL
PEDILWRQKEQFSDGVGYSWIDGLKDAAEEAISDEMLATPRPEWGDDQPTTKEAYWYRLK
FDKFFP-KSAANTVMRWIPKADWGCHGDPSGRFAKIHEQHIDN-
>AFR303W
MCGIFACYRKDDIESFKPTALRLSKRVRHRGPDWSGNVIKNDTILVHERLAIVGLDSGAQ
PINSPDGNYVLCVNGEIYNHIHLREECSDYEFTSLSDCEPIIPLYLKYDVETPQHLDGMF
AWCLYDVQRDRIVAARDPIGVTTLYMGKSSSSPRTRYFASELKCLVDECDEITAFPPGHV
YDSDTDKLTRYFKPDWIDETRIPSQPVDYKAVRTTLEKAVRKRLMAEVPYGVLLSGGLDS
SLIASIAARETERANREAGDVY---ADG------K---HLAGMDDRGLLHTGGWSRLHSF
AIGLPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIHHLETYDVTTIRASTPMF
LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSPAEFHTETVKRVNNLHLADCLRANK
STMAWGLEARVPFLDREFLQLCMNIDPAEKMIAPQKGRIEKYILRKAFDTSDEPGVDPYL
PEEILWRQKEQFSDGVGYSWIDGLKDAAERAISDEQFANPNPAWGDDIPTTKEAFWYRLK
FDALFPQPTAAATVMRWVPKADWGCAEDPSGRYAKIHDQHISS-
>TBLA0C04430
MCGIFAAYKHPEVNAFKPRALQLTKRIRHRGPDWSGNVVKNTTLFAHERLAIVGLDSGAQ
PITSPCGNYMLTVNGEIYNHIQLREETTDYKYKTLGDCEPIIPMYLKYDVDAPNHLDGMF
AFVLYDSQKDRVIAARDPVGITTLYMGRNSKTPKTVYFASELKCLVDDCDSIIAFPPGHV
YDSETDKIERYFKPNWIDESIIPTTPVDLKQVRETLERAVRKRLMAEVPYGVLLSGGLDS
SLIASIAARETEKVMDETNTIDYEKQSDDAADASK---KLTGLDDSGNLQTQSWSKLHSF
AIGLPGAPDLKAARKVANFIGSIHHEHNFTIQEGLDALDDVIYHLETYDVTTIRASTPMF
LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADNLRANK
STMAWGLEARVPFLDRDFLNLCMNIDPNDKMIKPKEGKIEKYLLRKAFDTSDEPDVKPYL
PEEILWRQKEQFSDGVGYSWIDSLKDTAERVISDEMFANPKDHWGSDIPTTKEAYWYRLK
FDALFPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEQHIDG-
>KAFR0G03670
MCGIFAAFRHEDVTSFKSKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ
PITSPCGNYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPLYLRDDIDAPKSLDGMF
AWTLYDSKKDRILAARDPIGVTTLYMGRSSMSPKTVFFASELKCLVDDCDSIVAFPPGHI
YDSETDKITRYFTPNWIDENKIPTTPVDYTAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS
SLIASIAARETEAANRELDASQYA-EEG------S---HLAGIDDEGHLRTSGWSRLHSF
AIGLPGAPDLIAAKKVAKFIGSIHHEHTFTLQEGIDALDDVIYHLETYDVTTIRASTPMF
LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANK
STMAWGLEARVPFLDREFLDLCMNIDPNDKLINQKEGRIEKYILRKAFDTKDDPSAKPYL
PDEILWRQKEQFSDGVGYSWIDCLKDTAEKVISDEMFANPKSHWGKDIPTTKEAYWYRLK
FDALFPQPTAAETVMRWIPKADWGCAEDPSGRYAQIHEKHIQ--
>KNAG0A07920
MCGIFATFRHEDVQAFKPRALQLSKRIRHRGPDWSGNIIKNSTIMAHERLAIVGLDSGAQ
PITSPCGDYILSVNGEIYNHIQLREECPEYQYKSLSDCEPIIPMYLKYDLDAPKHLDGMF
AWCLYDAKKDRIVAARDPIGITTLYMGRSSMCPKTVFFASELKCLTDDCDNIIAFPPGHV
YDSETDKITRYYTPNWLDETKIPSTPVDLKQIRHTLEKAVRKRLMAEVPYGVLLSGGLDS
SLIAAIAARETEKANKELDPRKYDEQEE------AEGHHLAGIDDEGNLLSATWSRLHSF
AIGLPGAPDLVAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANK
STMAWGLEARVPFLDKEFLDLCMNIDPKDKLINQKEGRIEKYILRKAFDTCDEPDVKPYL
PEEILWRQKEQFSDGVGYSWIDGLKDTAETVISDEMFAAPKAHWGIDVPTTKEAFWYRLK
FDALFPQPTAAETVMRWIPKADWGCAEDPSGRFAKIHEQHVEDA
>TDEL0D05520
MCGIFAAHKHEDVQAYKQKALQLSKRIRHRGPDWSGNVLRNNTLLVHERLAIVGLDSGAQ
PITSPCGNYTLCVNGEIYNHIKLREEFSDYKFSTLSDCEPIIPLYEKYDIDTPKYLDGMF
AWCLYDAKQDRIIAARDPVGITTLYMGRNSLSPKTVFFASELKCLTDDCDNIVAFPPGHI
YDSKTDKITRYFTPDWLDETRIPSNPVDYKAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS
SLIASIAARETEKANAEIDAQKYD-SED------K---HLAGIDDSGNLHSAGWSRLHSF
AIGLPGAPDLKAASKVAKFIGSIHHEHTFTLQEGLDALDDVIWHLETYDVTTIRASTPMF
LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPNANEFHTEAVKRVKNLHLADCLRANK
STMAWGLEARVPFLDREFLQLCMNIDPKDKMINKEEGRMEKYILRKAFDTTDEPDVKPYL
PEEILWRQKEQFSDGVGYSWIDGLKDTAERVISDDIFAAPKSAWGDDVPTTKEAFWYRLK
FDALFPQKTAADTVMRWVPKADWGCAEDPSGRFAQIHDQHVKN-
>Suva_16.474
MCGIFAAFKHEDVHRYKPKALQLSKRIRHRGPDWSGNAVKNSTIFVHERLAIVGLDSGAQ
PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF
AWTLYDAKQDRIIAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV
YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS
SLIAAIAARETAKATNDVEPSTYD-NKA------R---HLAGVDDEGNLHTAGWTSLHSF
AIGLPNAPDLQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANK
STMAWGLEARVPFLDREFLQLCMNIDPSEKMIRPKEGRIEKYILRKAFDTTDEPETKPYL
PEEILWRQKEQFSDGVGYSWIDSLKDTAEAVISDEMFANPKAEWGNDIPTTKEAYWYRLK
FDGLFPQKTVADTVMRWVPKADWGCAEDPSGRYAQIHEKHID--
>Skud_16.439
MCGIFAAYKHEDVHRYKQKALQLSKRIRHRGPDWSGNATKNSTIFVHERLAIVGLESGAQ
PITSPDEDYMLCVNGEIYNHIQLREECPDYQFKTLSDCEPIIPMYLKHDIEAPKYLDGMF
AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV
YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPFGVLLSGGLDS
SLIASIAARETANATNDVEPSTYD-SKA------R---HLAGVDDDGNLHTAGWTSLHSF
AIGLPNAPDLQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANK
STMAWGLEARVPFLDREFLQLCMNIDPKEKMIRAKEGRIEKYILRKAFDTTGEPDAKPYL
PEEILWRQKEQFSDGVGYSWIDSLKDNAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLK
FDALFPQKTVADTVMRWVPKADWGCAEDPSGRYAQIHEKHIE--
>Smik_16.396
MCGIFAAFKHEDVHNYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGLESGAQ
PITSPDEDYMLCVNGEIYNHIQLREECPEYQFKTLSDCEPIIPMYLKHDIDAPKYLDGMF
AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV
YDSKTDKITRYFTPDWLDEKRIPSTPIDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS
SLIASIAARETANATNDVDPSTYD-SKA------R---HLAGVDDDGKLHTAGWTSLHSF
AIGLPNAPDLQAARKVAKFIGSTHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANK
STMAWGLEARVPFLDKEFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYL
PEEILWRQKEQFSDGVGYSWIDGLKDTAETVISDEMFASPKAEWGSDIPSTKEAFWYRLK
FDALFPQKTVADTVMRWIPKADWGCAEDPSGRYAQIHEKHID--
>YPR145W
MCGIFAAFRHEDVHRYKPKALQLSKRIRHRGPDWSGNAIKNSTIFVHERLAIVGVESGAQ
PITSSDGEYMLCVNGEIYNHIQLREECADYEFGTLSDCEPIIPMYLKHDIDAPKYLDGMF
AWTLYDAKQDRIVAARDPIGITTLYMGRSSASPKTVYFASELKCLTDDCDTITAFPPGHV
YDSKTDKITRYFTPDWLDEKRIPSTPIDYMAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS
SLIASIAARETAKATNDVEPSTYD-SKA------R---HLAGIDDDGKLHTAGWTSLHSF
AIGLPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANK
STMAWGLEARVPFLDREFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTGEPDAKPYL
PEEILWRQKEQFSDGVGYSWIDGLKDTAEAVISDEMFASPKAEWGSDIPTTKEAFWYRLK
FDALFPQKTVADTVMRWIPKADWGCAEDPSGRYAQIHEKHIE--
>Suva_7.410
MCGIFAAFKHEDIEDFKPKALQLSKRIRHRGPDWSGNAIMNSTIFVHERLAIVGLDSGAQ
PITSSDGDYMLGVNGEIYNHIQLREQCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF
AFCLYDSKKDRVIAARDPIGVVTLYMGRCSKSPKTVYFASELKCLTDVCDSIIAFPPGHV
YDSETDKITRYFTPDWLDEKRVPTTPVDYRAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS
SLIAAIAARETETANVEANEEAS--AEK------S---KLAGIDDQGHLHTSGWSRLHSF
AVGLPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANK
STLAWGLEARVPFLDKDFLQLCMNIDPKDKMINSKEGRIEKYILRKAFDTTDEPDVKPYL
PEEILWRQKEQFSDGVGYSWIDSLRDTAERVISDAMFANPKASWGDDIPTTKEAYWYRLK
FDAWFPQKTAADTVMRWVPKADWGCAEDPSGRYAQIHEKHVNA-
>YGR124W
MCGIFAAFKHEDIHNFKPKALQLSKKIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ
PITSADGEYMLGVNGEIYNHIQLREMCSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF
AFCLYDSKKDRIVAARDPIGVVTLYMGRSSQSPETVYFASELKCLTDVCDSIISFPPGHV
YDSETDKITRYFTPDWLDEKRIPSTPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS
SLIAAIAARETEKANADANEDNN--VDE------K---QLAGIDDQGHLHTSGWSRLHSF
AIGLPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANK
STMAWGLEARVPFLDKDFLQLCMNIDPNEKMIKPKEGRIEKYILRKAFDTTDEPDVKPYL
PEEILWRQKEQFSDGVGYSWIDGLRDTAERAISDAMFANPKADWGDDIPTTKEAYWYRLK
FDAWFPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVSA-
>Smik_6.220
MCGIFAAFKHDDIHSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ
PITSADGEYMLGVNGEIYNHIQLREECSDYKFQTFSDCEPIIPLYLEHDIDAPKYLDGMF
AFCIYDAKKDRIVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIIAFPPGHV
YDSQTDKITRYFTPDWLDEKRIPSTPVDYLAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS
SLIAAIAARETEKANADVNEESS--VDE------K---QLAGIDDQGHLHTSGWSRLHSF
AIGLPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANK
STMAWGLEARVPFLDKDFLQLCMNIDPKDKMIKPKEGKIEKYILRKAFDTTNEPDVKPYL
PEEILWRQKEQFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGDDIPTTKEAYWYRLK
FDAWFPQKTAANTVMRWVPKADWGCAEDPSGRYAKIHEKHVGA-
>Skud_7.435
MCGIFAAFKHEDINSFKPKALQLSKRIRHRGPDWSGNAVMNSTIFVHERLAIVGLDSGAQ
PIASADGEYMLGVNGEIYNHIQLREKCSGYKFQTFSDCEPIIPLYLEHDIDAPKHLDGMF
AFCLYDAKKDRVVAARDPIGVVTLYMGRSSKSPKTVYFASELKCLTDVCDSIISFPPGHV
YDSETDKITRYFTPNWLDEKRIPSVPVDYHAIRHSLEKAVRKRLMAEVPYGVLLSGGLDS
SLIAAIAARETEKANADADGDAS--VNN------K---QLAGIDDQGHLHTSGWSRLHSF
AVGLPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVQRVKNLHLADCLRANK
STMAWGLEARVPFLDRDFLQLCMNIDPKDKMINPKEGRIEKYILRKAFDTTDEPEVKPYL
PEEILWRQKEQFSDGVGYSWIDGLRDTAERVISDTMFANPKADWGNDIPTTKEAYWYRLK
FDAWFPQKTAADTVMRWVPKADWGCAEDPSGRYAKIHEKHVSA-
>KLTH0F14630g
MCGIFTCFRHQSVEEFKPDALRLVKRIRHRGPDWSGNIIKNSTLMAHERLAIVGLDSGAQ
PFVSEDNNYILGVNGEVYNHIQLREEFSSYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF
AWALYDAKKDRIVAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV
YDSETDQITRYFNPDWIDEDRIPSEPLDLLKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS
SLIASIAARETEKANSQMDPVKYD-SED------K---HLAGVDDAGNLRSAGWSHLHSF
AIGLPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALSDVIYHLETYDVTTIRASTPMF
LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANK
STMAWGLEARVPFLDREFLQLCMNLDPKEKMINAAEGRIEKYILRKAFDTSDEPGAKPYL
PEEILWRQKEQFSDGVGYSWIDGLKDAAEAAISDEQFKQPKAEWGDDIPTTKEAYWYRLK
FDALFPQKTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHIDK-
>Kwal_55.21187
MCGIFTCFRHEDVDKFKPDALQLAKRIRHRGPDWSGNVIRNSTLLAHERLAIVGLDTGAQ
PMVSEEKDYILAVNGEIYNHIQLREEFSDYPFKTLSDCEPIIPLYEKYGIDAPKYLDGMF
AWALYDTKKDRMIAARDPIGITTLYMGRDSKSPKTVYFASELKCLTDNCDSIIAFPPGHV
YDSETDQITRYYTPNWLDENRIPSEPLDLLKIRNSLEKAVRKRLMAEVPYGVLLSGGLDS
SLIAAIAARETEKANTEMNPVEYD-SED------K---HLAGVDDSGKLHSAGWSRLHSF
AVGLPNAPDLEAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANK
STMAWGLEARVPFLDREFLDLCMNLDPKEKMINQAEGRIEKYILRKAFDTSDEPGAKPYL
PEEILWRQKEQFSDGVGYSWIDGLKDTAEATISDEQFKQPKAEWGDDIPTTKEAYWYRLK
FDALFPQKTAASTVMRWIPKADWGCAEDPSGRYAKIHDQHISK-
>NDAI0B05810
MCGIFAAFKHEDVHAFKPRALQLSKRIRHRGPDWSGNVIKNTTILAHERLAIVGLDSGAQ
PITSPCGNYTLCVNGEIYNHIQIREQFPDYPFKTLSDCEPIIPLYLKHDIDTPKHLDGMF
AWCLYDSKQDRIIAARDPIGITTLYMGRNSKTPQTVFFASELKCLTDDCDSIIAFPPGHV
YDSKTDQITRYFTPDWLDEQRIPENKLDLTAIRESLESAVRKRLMAEVPFGVLLSGGLDS
SLIASIAARETEKANAQATLDNENANDE------TSKAHLTGVDDEGHLHNGGWSKLHSF
AIGLPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVNNLHLADCLRANK
STMAWGLEARVPFLDRDFLQLCMNIDPKEKMINQAEGRIEKYILRKAFDTSDDPEAKPYL
PEEILWRQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKDHWGTDIPTTKEAYWYRLK
FDALYPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVNA-
>NCAS0F03510
MCGIFAAFRHEDVKAYKPKALQLTKRIRHRGPDWSGNVVKNTTILAHERLSIVGLDSGAQ
PITSPCGNYTLCVNGEIYNHIQIREECADYQFKTLSDCEPIIPLYLKYDLDAPKHLDGMF
AWCLYDAKQDRIVAARDPIGITTLYMGRQSKTPQTVYFASELKCLTDDCDSIVAFPPGHV
YDSNTDQITRYFNPDWLDEDRIPSTPVDLKAIRETLEKAVRKRLMAEVPYGVLLSGGLDS
SLIASIAARETEKAMQDVDVEDENGEHH------K---HLTGVDDEGHLHTGGWSRLHSF
AIGLPNAPDLQAARKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANK
STMAWGLEARVPFLDKEFLQLCMNIDPKDKMIDQASGKIEKYILRKAFDTTDDPEEKPYL
PQEILWRQKEQFSDGVGYSWIDGLKDTAERVISDAMFENPKPHWGNDVPTTKEAYWYRLK
FDALYPQKTAADTVMRWIPKADWGCAEDPSGRYAKIHEKHVDGN
>KLLA0B10868g
MCGIFASFRNPDVQAYKPKALQLSKRIRHRGPDWSGNIVKNSTILVHERLAIVGLDSGAQ
PITSEDGSYTLAVNGEIYNHIMLREECASYPFKTLSDCEPIIPLYEKYDIDAPKHLDGMF
AWCLYDSKKDRIIAARDPIGITTLYMGRSSASPKSVWFSSELKCLTDDCDEIIAFPPGHV
YDSETDKLTRYFTPDWLDESRIPTTPVDFKAVRESLEKAVRKRLMAEVPYGVLLSGGLDS
SLIAAIAARETEKTNAELDPVVYD-SDP------H---QLAGLDEQGHLHAAGWSRLHSF
AVGLPNAPDLQAARKVATFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANK
STMAWGLEARVPFLDRDFLQLCMNIDPNDKMIKPAEGKIEKYILRKAFDTTDEPDLKPYL
PEEILWRQKEQFSDGVGYSWIDGLKDAAESTISDEQFAQPKAEWGDDIPTTKEAYWYRLK
FDALFPQKTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHVDKK
>SAKL0F02970g
MCGIFACYKHESVQEFKPKALQLSKRIRHRGPDWSGNVVKNTTILAHERLAIVGLDSGAQ
PITSEDGDYTLCVNGEIYNHIKLREELTSYPFKTLSDCEPIIPLYQKYDIDTPKYLDGMF
AWCLYDAKKDRIIAARDPIGITTLYMGRSSSSPSTVFFASELKCLVDDCDEITAFPPGHV
YDSATDKITRYYTPDWLDEERIPKTPLDYKLIRNSLESAVRKRLMAEVPYGVLLSGGLDS
SLIAAIAARETEKANKDLDPVAYD-DED------K---HLAGVDDKGNLHAAGWSRLHSF
AIGLPNAPDLQAARKVAKFISSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHVESVKRVKNLHLADCLRANK
STMAWGLEARVPFLDRDFLDVCMNIDPAEKMINQSEGRIEKYILRKAFDTTDEPDVKPYL
PEEILWRQKEQFSDGVGYSWIDGLKDAAEAAISDEQFAQPKPEWGDDIPTTKEAYWYRLK
FDALFPQKTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHIQN-
>TPHA0D04200
MCGIFTVYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTIMAHERLAIVGLDSGAQ
PITSQDGDHILCVNGEIYNHIQIREQFPDYQFKTLSDCEPIIPLYMKYGAEAPKHLDGMF
AWTLYDAKQDRIIAARDPIGITTLYMGRSSKSPKTVYFASELKCLTDDCDSIVAFPPGHV
YDSVTDQITRYYTPDWIDENRIANQPLDLMKIRHSLEKAVRKRLMAEVPYGVLLSGGLDS
SLIASIAARETEKAMKTASSDSLS-SSV------N---QLTGIDDNGNLRSSGWSRLHSF
AIGLPGAPDLIAAKKVAKFIGSVHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLSDCLRANK
STMAWGLEARVPFLDREFLDLCMNIDPSEKMINQKEGRIEKYILRKAFDTTDEPNEKPYL
PDEILWRQKEQFSDGVGYSWIDGLKDTAERVISDELFENPREHWGSDIPTTKEAYWYRLK
FDALFPQPTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHIGAK
>CAGL0I10648g
MCGIFAAYKHQDVHAFKPKALQLSKRIRHRGPDWSGNVVKNSTIMVHERLAIVGLDSGAQ
PITSEDGDYTLCVNGEIYNHIQLREQFPDYKFKTLSDCEPIIPAYLEHDIDAPKYLDGMF
AWCLYDAKQDRIVAARDPVGITTLYMGRCSSSPKTVFFASELKCLTDDCDEITAFPPGHV
YDSKTDQITRYFTPDWIDESRIPTTPVNFKDIRESLEKAVRKRLMAEVPYGVLLSGGLDS
SLIASIAARETEKANEENDAADNDASAS------K---QLAGIDNQGHLHTAGWSRLHSF
AIGLPNAPDLQAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSATEFHIESVKRVKNLHLADCLRANK
STMAWGLEARVPFLDKEFLQLCMNIDPKDKMIDQSAGRIEKYILRKAFDTSDEPDVKPYL
PEEILWRQKEQFSDGVGYSWIDGLKDTAERVISDTMFSNPKIEWGEDIPTTKEAYWYRLK
FDALFPQKTAASTVMRWIPKADWGCAEDPSGRYAKIHEQHVTA-
>Kpol_480.19
MCGIFAAYKHENAEAFKPRALQLSKRIRHRGPDWSGNVVKNSTILVHERLAIVGLDSGAQ
PITSPCGDYVLCVNGEIYNHIQLRESCPDYKYKTLSDCEPIIPLYLKHDIDAPKYLDGMF
AWCLYDAKKDRIIAARDPIGITTLYMGRNSKSPKTVFFASELKCLTDDCDSIMAFPPGHV
YDSETDQITRYFSPDWIDEQRIPTEPVSYKAIRESLEKAVRKRLMAEVPYGVLLSGGLDS
SLIASIAARETEKAMKEMDTTAYD-SED------K---HLTGIDDQGNLHTAGWSRLHSF
AIGLPNAPDLLAARKVAKFIGSIHHEHTFTLQEGLDALDDVIYHLETYDVTTIRASTPMF
LLSRKIKAQGVKMVLSGEGSDEIFGGYLYFAQAPSAAEFHTESVKRVKNLHLADCLRANK
STMSWGLEARVPFLDREFLQLCMNIDPAEKMINASEGRIEKYILRKAFDTSDEPDEKPYL
PEEILWRQKEQFSDGVGYSWIDGLKDTAERVISDELFSTPKEHWGADIPTTKEAYWYRLK
FDALFPQKTAAETVMRWIPKADWGCAEDPSGRYAKIHEQHIGDK