MUSCLE (3.8) multiple sequence alignment

AFR268C            -MSVDGASLGEQLLEAARRNNVELLEAVVRDAGPE---IEDLINGSRDPLGNTCLHLCCT
KLLA0A00781g       --MTEGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSK
TBLA0I03490        MSTTQGASYSEQLLEAARRNNIDLLNNIVTGLNNDPTKIAHLLNESKDAFGNTALHLCAK
Ecym_2595          MDEIEGATYGEQLLDASRRNNVDLLEFILEQ---DSNIVAKLINDTKDPFGNTCLHMCCK
KAFR0J00180        -METEGASFGEQLLDASRRNNVDLLETVFSDLANDHKKIADLINSSKDPFGNTALHLSCK
TPHA0A05990        -MSSEGASLNEQLLDCARRNNEDLFNSILESLGNDTYNISELINTSRDPFGNTALHLACQ
TDEL0D06330        -MSSEGASYGEQLLEASRRNNVDLLNDILESVKNDPVKIAEIVNFSKDPFGNTALHLCCK
ZYRO0E09482g       -MDKEGASFGEQLLDASRRNNIDLLKMVFEGLGGDPERISELINESRDPLGDTALHLCCR
Kpol_507.11        -MSTEGASLSEQLLDLSRRNNVDLLDTILETLENDPEKIAGLINTSKDPFGNTALHLCCK
Suva_7.19          -MDTEGASLSEQLLDAARRNNLDLVETVFDSLDNDPEKIAKLINESREPLGNTALHLCCK
Smik_7.19          -MDTEGASLSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCK
Skud_7.25          -MDTEGASLSEQLLDAARRNNLDLLETVFDGLDGDSEKIAKLINKSKEPLGNTALHLCCK
YGL242C            -MNTEGASLSEQLLDAARRNNLDLLETVFDSLDNDPEKIAKLINESKEPLGNTALHLCCK
SAKL0F00858g       MSEIQGASLQEQLLDASRRNNADLLETILESLDNNPDKIAKLINSACDPLGNTCLHLCCK
KLTH0G00770g       --MSDGASLREQLLDASRRNNVDLLETVFQELGNNEAQIADLINTAHDPMGNSGLHLCCM
Kwal_47.19262      --MSQGASFREQLLDASRRNNVDLLETVFQELNNDEKKIAELINTAHDPMGNSSLHLCCK
CAGL0H07755g       -MSSEGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCK
NCAS0F03960        -MSVEGASLKEQLLDASRRNNVDLLEQAFNDLDNDPKKIADLINTAKDPLGNTALHLASK
NDAI0B06270        -MSVEGASLKEQLLDASRRNNVDLLEQIFTTLDNDEEKIADLINTAKDPLGNTALHLSCK
KNAG0D02950        -MSVKGASLSEQLLDASRRNNDDLLEQVFKQLDNDPGKIAELINTARDPMGNTALHLCCK
                       .**:  ****: :**** :*..  .     :   :  ::* : :.:*:: :*:.. 

AFR268C            HGSWEALDMILDLDCAIEVDPQNTA-GDTPLHAAARYAAEEPEHATFLASNLVQVGADPR
KLLA0A00781g       YGSWDVLDVLLDQEG-VDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPR
TBLA0I03490        HGSWDVLDKLLDQEGDIEVDPQNITDGDTPLHCAVRLAQDEPEEGTFIAKNLIAVGADPR
Ecym_2595          YGSWDVLDTILDVDCPIEIDPQN-VEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPR
KAFR0J00180        YGSWEVLDKILDLEGDIEIDPKNNIDGETPLHCAVKYSQTEPEHGTFIASNLIQVGADPR
TPHA0A05990        YGSWEVLDKILDQEGDIEIDPQNTTDGDTPLHVTVKYAHNEPEHGTFIAKNLIEVGADPR
TDEL0D06330        SGSWEVLDILLDQ-GDIEIDPQNKLDGDTPLHFTVRYAQDEPEHGTFIARNLIEVGADPR
ZYRO0E09482g       YGSWEVLDEILDQDG-IEIDPQNTKELDTPLHVTVRYAHDEPEHGTFIARNLVEVGADPR
Kpol_507.11        YGSWEVLDKILDQEGDIEIDPKNTTDGDTPLHVTVRYSMEEPEHGTFIASNLIEVGSDPR
Suva_7.19          YGSWEVLDKILDQDGGIEIDPQNDVDGDTPLHVTVKYSQEEPEHGTFIARNLIEVGADPR
Smik_7.19          YGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPR
Skud_7.25          YGSWEVLDRILDQDGGIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPR
YGL242C            YGSWEVLDKILDQDGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPR
SAKL0F00858g       YGSWEVLDRILDQDGGIEIDPRNNVDGDTPLHVTVRYAIEEPEHGTFIAQNLIEVGADPR
KLTH0G00770g       YGSWDVLDVILDQEGGIEIDSKNKVEGDTPLHCAVRYAIEEPEHGTFIARNLIEVGADPR
Kwal_47.19262      SGSWEVLDIILDQEGGIEIDCKNSVEGDTPLHVTVRYAIEEPEHGTFIARNLIEVGADPR
CAGL0H07755g       YGSWEVLDTILDQEGGIDIDPQN-VDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPR
NCAS0F03960        YGSWEVLDKILDLDGDIEIDPQNDIDGDTPLHEAVRYAKEEPEHGTFIAQNLIEVGADAR
NDAI0B06270        YGSWEVLDKILDQEGDIEIDPKNDMDGDTPLHSAVRYAQDEPEHGEFIAQNLIEVGADPR
KNAG0D02950        YGSWEVLDKILDQEGDIEIDPRNELDGDTPLHLAVRYAMDEPEHGTFIANNLVEVGADAR
                    ***:.** :**    :::: .*    :*.**  .. .  *** . *:* **: **:*.*

AFR268C            VRNKAGLRPVELVHGSELEPLVDVLQGGELAYDTHGEAVNADEI---EEIDDEPSD----
KLLA0A00781g       IRNKRGQTPLQLVHSDELESLVNLLQGAEIAADNKGKIINEEDA---EEIDDGPEDD---
TBLA0I03490        IRNKQNQKPVDLIHGNSLTALVDTLQGAELAVATGAHGVAADDDEDGEIVEEDDD-----
Ecym_2595          IKNNSGRKPIELIHNDKFTDLIDLLQSAELAADNKGTAINENEA---EVIDDSPEDG---
KAFR0J00180        LKNNNNQRPIDLIHSEELDDLIDLLQGAELAADHANEAINESEA---ELIEDEDDDREDV
TPHA0A05990        IRNNRNERPIDCIHGDELEELIDLLQGAEISADNGGVN--DEEDIEEDNVDNGDDDDDN-
TDEL0D06330        LRNKHNQKPIDLIHSEDLDELTDLLQGAELAIDMGGHQAEEDED----IIDDGSDDEDVD
ZYRO0E09482g       IKNMNGDKPVDLIHGDDLDELIDLLQGAELAADNDRV---DDGE-EGEIIEDDGEDVDDE
Kpol_507.11        IKNNSNQKPIDLIHGDELDDLIDLLQGAEIAADSRGT---RDEEFEGEVVEEEEADDNDD
Suva_7.19          IKNYNNQKPIDLVHGDELDELIDLLQGAELAIDSNNGLADKDES--EEIIDDGPSDDDED
Smik_7.19          VRNYNNQKPIDLVHGDELDELIDLLQGAELAIDNTNGLADNNED--EEMIDDGSSDDDEA
Skud_7.25          VRNYNNQKPIDLVHGDELDELIDLLQGAELAIDSTNGLADNNED--EEMIDDSPSDDDEN
YGL242C            VRNYNNQKPVDLVHGDELDELIDLLQGAELAIDSTNGSGDNNED--GEMIDDGPSDDDEE
SAKL0F00858g       IRNKAGQKPVDLIHGDGLDDLLDLLQGAELAADNEGVI--NEED--AEIIDDGPEDE---
KLTH0G00770g       IVNQAGQKPIDLVHGDELDDLIDLLQGAELAAENQGAV--NEED--AEVIDDGPDDD---
Kwal_47.19262      IINKAGQKPLDLVHGNDLDDLVDLLQGAELAAENHGVV--NEDD--AELIDDGPEDD---
CAGL0H07755g       IKNINNQLPLDLVHGDDKDELIDLLQGAALAADNYDG---DEGD-EPELIDDDDGEED--
NCAS0F03960        IANKHNQKPVDLIHGDELDDLVDLLQGAELAADT-GVVGETEDEVEGEVVEDDDDSADDV
NDAI0B06270        IRNNHNQKPIDLIHGDDFDSLIDLLQGAELAADNRGNIENEEGE-EEELIDDGPDDEDVP
KNAG0D02950        IKNNNNQKPVDLIHGDELDDLFDLLQGAELARDHPGAI--NEDE--VELIDDDDNDDDE-
                   : *  .  *:: :*..    * : **.. ::          .       :::        

AFR268C            -------------
KLLA0A00781g       -------------
TBLA0I03490        -------------
Ecym_2595          -------------
KAFR0J00180        PISAAN-------
TPHA0A05990        -------------
TDEL0D06330        LDSRN--------
ZYRO0E09482g       D------------
Kpol_507.11        GDNGDDGVKDTKK
Suva_7.19          DDKN---------
Smik_7.19          DDRK---------
Skud_7.25          DDKR---------
YGL242C            DDKK---------
SAKL0F00858g       -------------
KLTH0G00770g       -------------
Kwal_47.19262      -------------
CAGL0H07755g       -------------
NCAS0F03960        DIDVKAVE-----
NDAI0B06270        IKAN---------
KNAG0D02950        -------------
                                

FASTA FORMAT for MUSCLE Version 3.6

>AFR268C
-MSVDGASLGEQLLEAARRNNVELLEAVVRDAGPE---IEDLINGSRDPLGNTCLHLCCT
HGSWEALDMILDLDCAIEVDPQNTA-GDTPLHAAARYAAEEPEHATFLASNLVQVGADPR
VRNKAGLRPVELVHGSELEPLVDVLQGGELAYDTHGEAVNADEI---EEIDDEPSD----
-------------
>KLLA0A00781g
--MTEGASLKEQLLDASRRNNADLLNAVLETLDGDKQAIQSLINDSKDPLGNTAIHLCSK
YGSWDVLDVLLDQEG-VDVNQQNSIDGDTALHLCVNYSHDEPEYGTFIAENLIEVGADPR
IRNKRGQTPLQLVHSDELESLVNLLQGAEIAADNKGKIINEEDA---EEIDDGPEDD---
-------------
>TBLA0I03490
MSTTQGASYSEQLLEAARRNNIDLLNNIVTGLNNDPTKIAHLLNESKDAFGNTALHLCAK
HGSWDVLDKLLDQEGDIEVDPQNITDGDTPLHCAVRLAQDEPEEGTFIAKNLIAVGADPR
IRNKQNQKPVDLIHGNSLTALVDTLQGAELAVATGAHGVAADDDEDGEIVEEDDD-----
-------------
>Ecym_2595
MDEIEGATYGEQLLDASRRNNVDLLEFILEQ---DSNIVAKLINDTKDPFGNTCLHMCCK
YGSWDVLDTILDVDCPIEIDPQN-VEGDTPLHTVVKYSEEEPEHGTFIASNLIQVGADPR
IKNNSGRKPIELIHNDKFTDLIDLLQSAELAADNKGTAINENEA---EVIDDSPEDG---
-------------
>KAFR0J00180
-METEGASFGEQLLDASRRNNVDLLETVFSDLANDHKKIADLINSSKDPFGNTALHLSCK
YGSWEVLDKILDLEGDIEIDPKNNIDGETPLHCAVKYSQTEPEHGTFIASNLIQVGADPR
LKNNNNQRPIDLIHSEELDDLIDLLQGAELAADHANEAINESEA---ELIEDEDDDREDV
PISAAN-------
>TPHA0A05990
-MSSEGASLNEQLLDCARRNNEDLFNSILESLGNDTYNISELINTSRDPFGNTALHLACQ
YGSWEVLDKILDQEGDIEIDPQNTTDGDTPLHVTVKYAHNEPEHGTFIAKNLIEVGADPR
IRNNRNERPIDCIHGDELEELIDLLQGAEISADNGGVN--DEEDIEEDNVDNGDDDDDN-
-------------
>TDEL0D06330
-MSSEGASYGEQLLEASRRNNVDLLNDILESVKNDPVKIAEIVNFSKDPFGNTALHLCCK
SGSWEVLDILLDQ-GDIEIDPQNKLDGDTPLHFTVRYAQDEPEHGTFIARNLIEVGADPR
LRNKHNQKPIDLIHSEDLDELTDLLQGAELAIDMGGHQAEEDED----IIDDGSDDEDVD
LDSRN--------
>ZYRO0E09482g
-MDKEGASFGEQLLDASRRNNIDLLKMVFEGLGGDPERISELINESRDPLGDTALHLCCR
YGSWEVLDEILDQDG-IEIDPQNTKELDTPLHVTVRYAHDEPEHGTFIARNLVEVGADPR
IKNMNGDKPVDLIHGDDLDELIDLLQGAELAADNDRV---DDGE-EGEIIEDDGEDVDDE
D------------
>Kpol_507.11
-MSTEGASLSEQLLDLSRRNNVDLLDTILETLENDPEKIAGLINTSKDPFGNTALHLCCK
YGSWEVLDKILDQEGDIEIDPKNTTDGDTPLHVTVRYSMEEPEHGTFIASNLIEVGSDPR
IKNNSNQKPIDLIHGDELDDLIDLLQGAEIAADSRGT---RDEEFEGEVVEEEEADDNDD
GDNGDDGVKDTKK
>Suva_7.19
-MDTEGASLSEQLLDAARRNNLDLVETVFDSLDNDPEKIAKLINESREPLGNTALHLCCK
YGSWEVLDKILDQDGGIEIDPQNDVDGDTPLHVTVKYSQEEPEHGTFIARNLIEVGADPR
IKNYNNQKPIDLVHGDELDELIDLLQGAELAIDSNNGLADKDES--EEIIDDGPSDDDED
DDKN---------
>Smik_7.19
-MDTEGASLSEQLLDAARRNNLDLLETVFNSLDNNPEKIAKLINESREPLGNTALHLCCK
YGSWEVLDKVLDQEGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPR
VRNYNNQKPIDLVHGDELDELIDLLQGAELAIDNTNGLADNNED--EEMIDDGSSDDDEA
DDRK---------
>Skud_7.25
-MDTEGASLSEQLLDAARRNNLDLLETVFDGLDGDSEKIAKLINKSKEPLGNTALHLCCK
YGSWEVLDRILDQDGGIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPR
VRNYNNQKPIDLVHGDELDELIDLLQGAELAIDSTNGLADNNED--EEMIDDSPSDDDEN
DDKR---------
>YGL242C
-MNTEGASLSEQLLDAARRNNLDLLETVFDSLDNDPEKIAKLINESKEPLGNTALHLCCK
YGSWEVLDKILDQDGEIEIDPQNDVDGDTPLHVTVRYSQEEPEHGTFIARNLIEVGADPR
VRNYNNQKPVDLVHGDELDELIDLLQGAELAIDSTNGSGDNNED--GEMIDDGPSDDDEE
DDKK---------
>SAKL0F00858g
MSEIQGASLQEQLLDASRRNNADLLETILESLDNNPDKIAKLINSACDPLGNTCLHLCCK
YGSWEVLDRILDQDGGIEIDPRNNVDGDTPLHVTVRYAIEEPEHGTFIAQNLIEVGADPR
IRNKAGQKPVDLIHGDGLDDLLDLLQGAELAADNEGVI--NEED--AEIIDDGPEDE---
-------------
>KLTH0G00770g
--MSDGASLREQLLDASRRNNVDLLETVFQELGNNEAQIADLINTAHDPMGNSGLHLCCM
YGSWDVLDVILDQEGGIEIDSKNKVEGDTPLHCAVRYAIEEPEHGTFIARNLIEVGADPR
IVNQAGQKPIDLVHGDELDDLIDLLQGAELAAENQGAV--NEED--AEVIDDGPDDD---
-------------
>Kwal_47.19262
--MSQGASFREQLLDASRRNNVDLLETVFQELNNDEKKIAELINTAHDPMGNSSLHLCCK
SGSWEVLDIILDQEGGIEIDCKNSVEGDTPLHVTVRYAIEEPEHGTFIARNLIEVGADPR
IINKAGQKPLDLVHGNDLDDLVDLLQGAELAAENHGVV--NEDD--AELIDDGPEDD---
-------------
>CAGL0H07755g
-MSSEGASAGEQLLDASRRNNSDLLSSIFETLGHDAEKIAELINTSKDPLGNTALHLCCK
YGSWEVLDTILDQEGGIDIDPQN-VDGDTPLHVTVRYCDEEPEHGLFIARNLIEVGADPR
IKNINNQLPLDLVHGDDKDELIDLLQGAALAADNYDG---DEGD-EPELIDDDDGEED--
-------------
>NCAS0F03960
-MSVEGASLKEQLLDASRRNNVDLLEQAFNDLDNDPKKIADLINTAKDPLGNTALHLASK
YGSWEVLDKILDLDGDIEIDPQNDIDGDTPLHEAVRYAKEEPEHGTFIAQNLIEVGADAR
IANKHNQKPVDLIHGDELDDLVDLLQGAELAADT-GVVGETEDEVEGEVVEDDDDSADDV
DIDVKAVE-----
>NDAI0B06270
-MSVEGASLKEQLLDASRRNNVDLLEQIFTTLDNDEEKIADLINTAKDPLGNTALHLSCK
YGSWEVLDKILDQEGDIEIDPKNDMDGDTPLHSAVRYAQDEPEHGEFIAQNLIEVGADPR
IRNNHNQKPIDLIHGDDFDSLIDLLQGAELAADNRGNIENEEGE-EEELIDDGPDDEDVP
IKAN---------
>KNAG0D02950
-MSVKGASLSEQLLDASRRNNDDLLEQVFKQLDNDPGKIAELINTARDPMGNTALHLCCK
YGSWEVLDKILDQEGDIEIDPRNELDGDTPLHLAVRYAMDEPEHGTFIANNLVEVGADAR
IKNNNNQKPVDLIHGDELDDLFDLLQGAELARDHPGAI--NEDE--VELIDDDDNDDDE-
-------------