MUSCLE (3.8) multiple sequence alignment

KLLA0A00737g       MSDLDDDLLALAGAGTDEEEEDE-FLSTSKKHASK-ESSGSKRRRIMKDDEDEDEDEDDN
TBLA0E00220        MSDIDEDLLALAGADEEEEED---TLMVSSKKRARNNDSSSKRRKIEVDNEDEE------
CAGL0H07711g       MSDLDEDLLALAGADEEDEEE---VLTTTNKRTKGSSNSQVKKRRIEVDSED--------
ZYRO0E09526g       MSDIEEDLLALAGADEEEDDDE--VLASSAKRSGKSDRASSKKRRIEVEGGEDDEDE---
TDEL0D06350        MSDIEEDLLALAGADEEEDEDE--VLTTSAKRNKTSDNASSKRRKIAVEGAEEDEDEDED
Smik_7.17          MSDLDEDLLALAGADESEEEDQV-LTTTSAKRAKNNDQSLSKKRRIEVGNAEEDDEEDED
YGL244W            MSDLDEDLLALAGADESEEEDQV-LTTTSAKRAKNNDQSLSKKRRIEVGSVEDDD-----
Skud_7.23          MSDLDEDLLALAGADESEEEDQV-LTSTSAKRAKNNDQSVSKKRRIEVDSAEEEDEEDE-
Suva_7.17          MSDLDEDLLALAGADESEEEDQV-LTSTSAKRAKNNDQSISKKRRIEVGSAEEEEEEDE-
KNAG0I00230        MSDIDEDLLALAGADEEEDDERV-LTSTVSKRSKQSDATASKKRRIYEGSEEEVYDDEAD
KAFR0J02880        MSDIDEDLLALAGADEEEEEE---VLTTSKRTKQSGDSSANKKRRIESDSDE--------
NDAI0I03240        MSDIDEDLLALAGADEEEEDDEQ-LLTTSGKRAKNHDQVGSKRKKIEVDSEAEEE-----
NCAS0E00260        MSDLDEDLLALAGADEEEEDEQV--LTTSNKRAKNHEHASSKRKKIEVDSEAE-------
TPHA0A06000        MSDIEEDLLALAGVGDSEEEEDV-VISSTSKRGRSNEDSVSKKRHINVGED---------
Kpol_507.10        ------------------------------------------------------------
AFR266W            MSDLDEDLLALAAGEDGDDGDED-FGV-TSQKRSKHDSSGSKKRRVMDEESGDDEDNDND
Ecym_2597          MSDLDEDLLALAEGDDGDEDVMV-----SSKKRSKNDIAGSKKRMLMDDDDEDDSNDDED
SAKL0F00814g       MSDIDEDLLALAGAGSDEEEEEE-VKLASSKKRSQPENAPTKKRRIMDDDDDEGISNEDD
KLTH0G00726g       MSDIDEDLLALAGASSGEEEEED-VQIGSSKKRSRSDHQSSSKRRIVDEDEEQDDDEEEG
Kwal_47.19265      MSDIDEDLLALAGASSGEEEEEEGVNVGVSKKRSRSSQNASNKRRIVDEDEEIDEDDD--
                                                                               

KLLA0A00737g       ----DEEDDDGYMP------ADSFDNDEEE--EEEEEETDSIPFPLEGKYKDEKDREKLE
TBLA0E00220        -------EEDDYNP------VFNEDNNQSTYNTMDGEREEPNPFPLEGKYKDEDDREKIE
CAGL0H07711g       -------EEDDYNP--------DDGYEPVDVSDKEEEEEEENPFPLEGKYKDTADRDHLE
ZYRO0E09526g       -------DEDDYNP-----AASGAGTGDYD----DEEEEEENPFPLEGKYKDEADRDYLG
TDEL0D06350        -------EEDDYNP-----AAVQTESGRYSEEDEEDEEEEENPFPLEGKYKDDNDRAHLE
Smik_7.17          -------EEDDYNP-------YSVGNASYG----SEEVEEPNPFPLEGKYKNESDREHLE
YGL244W            -------EEDDYNP-------YSVGNADYG----SEEEEEANPFPLEGKYKDESDREHLE
Skud_7.23          -------EEDDYNP-------YSVGNAGYG-----SEGEEANPFPLEGKFKDENDREHLE
Suva_7.17          -------EEDDYNP-------YSVGNTGYG--SEEEEEVEPNPFPLEGKYKDESDREHLE
KNAG0I00230        ---DVDEEEDDYNP-------HEVGNYDTG--DDEAENEEQNPFPLQGKYKDEKDREYLE
KAFR0J02880        -------DEDDYNP-----AAIDGGDGAYNE-NDDEEEYEENPFPLEGKYKNEEDRDYLE
NDAI0I03240        -------EEDDYNP--------YGGNQ-----SEEEEIDEPNPFPLENKYKDEDDREHLE
NCAS0E00260        -------EEDDYDP----------GNFGAGNISEEEEEMEQNPFPLEGKYKDEADREQLE
TPHA0A06000        -------DEDDYNP-------ASAGLGD----DDDNDDEEEAPFPLEGKYRDERDRDYLE
Kpol_507.10        ------------------------------------------------------------
AFR266W            AGDEEDEDEDDYNP-----GTEYGFDEGHE--ASEDEVEEENPYPLLGKYRDDADREHIE
Ecym_2597          NDVEDSEGEDDYNP---GTQYDFEGNDD----GSGDEQEERNPYPLEGKYKDEEDRNRIQ
SAKL0F00814g       ----D--DEDSYHPGGLKEDATHGYEEGEE--EGEEEEEEDNPFPLEGKYKDEQDRTQLE
KLTH0G00726g       -------EEDDYNP----------EAASYDMDSEEDEDEEPNPFPLEGKYKNEEDRSYLE
Kwal_47.19265      -------DQDDYNP----ERGIYGDASGAE--DEEDEEEEENPFPLEGKYKDERDREYLE
                                                                               

KLLA0A00737g       LLPEMERESILFERSQQMQKYQERKLLRQHAKSIKQQQQLQ----REGSKSTRASTRSSR
TBLA0E00220        SMPEMERETLLFERSQIMQKYQERKMFRERSRKQMSLNNNS----NLTGQKTRTSTRVTH
CAGL0H07711g       SLPEMERETILFERSQVMRKYQERKLFRERGRNLKQQKIQA----GEDSQKTRSSNRSTR
ZYRO0E09526g       GLPEMERETMLFERSQIMQKYQDRKMFRQRGKNLKEQQQRS--KQQEEGKKTRSSTRSTV
TDEL0D06350        GLPEMERETLLFERSQIMQKYHDRRLFRERGRNMKEQQKNR---QLREGNKTRSSARTTH
Smik_7.17          SLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRA--KNDEDSRKTRTSTRSTH
YGL244W            SLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRA--KNDEDSRKTRASTRSTH
Skud_7.23          SLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRA--KDKEDSRKTRTSTRSTH
Suva_7.17          SLPEMERETLLFERSQIMQKYQERKLFRARGKDMKEQQQRKRARDDEDSRKTRTSTRSTH
KNAG0I00230        SLPEVERETVLFDRSQTMRKYQERKLFRERKR-------------QQEAKPTRSSGRTAH
KAFR0J02880        SLPEMERETVLYDRSQTMRKYRERQFFKDRNKNLKRQKERN---EDDEALKTRSSGRATH
NDAI0I03240        SLPEMERETLLFERSQVMRKYQERKLFRERQRNIKEQQERN--ELEEEGKKTRSSTRATH
NCAS0E00260        SLPEMERETLLFERSQTMRKYQERKLFRERQRNLKEQQQRN--APSEEGTKTRTSTRTTH
TPHA0A06000        SLPEMERETLLFERSQLMQKYKDRMLFRERQRTLKRQRESS------ENRKVRSSTRSSK
Kpol_507.10        ----MERETLLFERSQLMQKYQDRKLFRERQRNLKRQQRNN--TSAQEGKKTRTSTRSTQ
AFR266W            NMPEMERETLLFERSQEMQKYQERKVLRERAKNIRAQQQRR---QQKDGSALRSSGRSTR
Ecym_2597          DMPEMERETLLFERSQEMQKYQERKVLRQRAKSIRAQQQQR--QLQKDSTK-RSSGRSTR
SAKL0F00814g       SLPEMERESLLFERSQIMQQYQERRFLKQRAKNIRDQQQKR--QQQQEGKQVRSSTRTTR
KLTH0G00726g       SLPEMERETMLFERSQTMQKYQERRVLKERAKNIRDQQQKR--QLQQEGKKTRSSTRSTR
Kwal_47.19265      SLPEMERETLLFDRSQEMQKYRERRVLKERARNIRAQQQKR--QLQQESTKTRSSTRSTR
                       :***::*::*** *.:*.:* .:. . .                    *:* * : 

KLLA0A00737g       TTGHSDLKQSKLSELKKQRAKK-SGNYEFSDNESEDDYRSEDDSRGRRRRGDYDDEEE--
TBLA0E00220        TTGLSDAKSSKLSQLKRQRERRNKGQSNYSDEDEYEDEY-EDDL-------E-QEYKS--
CAGL0H07711g       ATGHSDIKASKLSQLKKQRERKSKGRRSSDYEESDEDNYGDEDE----F--K-DDFIE--
ZYRO0E09526g       ATGHSDIKASKLSQLRKQREKK-SQNRPYSDEEEEGED-------------EGDDYGY--
TDEL0D06350        ATGHSDLKASKLSQLRKQREQKGHRANRDRDFEEEEEE---------------EEDRY--
Smik_7.17          ATGHSDIKASKLSQLKKQRARK---NRHYSDNEGEVDD---EDE----YRED-DYKDD--
YGL244W            ATGHSDIKASKLSQLKKQRARK---NRHYSDNEDEDDE----ED----YREE-DYKDD--
Skud_7.23          ATGHSDIKASKLSQLKKQRARK---NRQYSDNEDEEDD---EDE----YRED-NYKNE--
Suva_7.17          ATGHSDIKASKLSQLKKQRARK---NRQYSDSEDEQDD---QEE----YRED-DYKND--
KNAG0I00230        STGHSDLKASKLSQLKRQRDKKLNRQRSDDEYEEDEEE--EEED-------DYNGYGDDL
KAFR0J02880        ATGHTDLKASKLSQLKKQREKK-NKSRQYSDYEEEEEE--DEEE----F--E-DEYR---
NDAI0I03240        ATGHSDLKASKLSQLKKQRERK-TRDQDYNDVEDEDDL----DD----YAPD-DNYKH--
NCAS0E00260        ATGHSDLKASKLSQLKKQRERKGLHRRGSDEEGSEFEE--EEEE----YDEE-EYKKD--
TPHA0A06000        VTGHSDVKSSKLSQLKKQRERKNNHHYSDEDDEDEYEE--EENI----Y--E-DKYE---
Kpol_507.10        ATGHSDVKASKLSQLKRQREKNKNRQYSESEGEYEEEE--DEDD----Y--D-TGYKY--
AFR266W            TTGHSDLRDSKLSELRKQRAKK-SGNYDYSAGEDDSDH-------------S-DDYVD--
Ecym_2597          TTGHSELRTSKLSELRKQRAKK-SGNYDYSESEEDESD-------------QSDNYAE--
SAKL0F00814g       ATGHSDVKTSKLSELKKQRAKK-SGTYDYSEDEEGDGD--DHKY---------DDYYD--
KLTH0G00726g       TTGHSDLKESRLSELKKQRAKK-KGTYEYSEEEEEEGQ--NEE----------DEYGY--
Kwal_47.19265      TTGHSDLKESRLSELKKQRAKK-SGTYDYSEDEDDGGR--DEE----------DDYGY--
                    ** :: . *.**:*..** ..                                      

KLLA0A00737g       -EESEYDE------EEDDYDL-GYEKSKT--RGRERADIHEVEWA---EDDNLDRESSLD
TBLA0E00220        -SGSDYDENEAAEEEEDDYDL-YGSKTKYNHRGSEEDDDDDVKWA-----EDIDRESNVQ
CAGL0H07711g       -EDSDYKEN---DDDEEGYDP-YARKSKYAQD-NDEEEDEEVEWA-----EQLDRDAEVQ
ZYRO0E09526g       -EDKKYSDEE----DEEEYDP-YSRRSRF--E----EDEDEVQWA---E-EALDREANVA
TDEL0D06350        -EGSEYEDE-----DEEDYDP-YNRKSHR--DARKGRRSGMGR-------DQLDREADIT
Smik_7.17          -EGSEYG-------DDEEYNP-FDRGDLY--D----KREEEVEWAEE-E-DELDREPEIS
YGL244W            -EGSEYG-------DDEEYNP-FDRRDTY--D----KR-EEVEWAEE-E-DEQDREPEIS
Skud_7.23          -EESEYE-------DDEEYNP-FDRKDLY--D----KREEEVEWAEEGE-DELDREPEIS
Suva_7.17          -EGSEYG-------DDEEYNP-FDRKGVY--D----KREEEVEWAEEEE-DELDRDPEIS
KNAG0I00230        NEDAEYQEDE----DEEDYNP-LAIKSKY--DELEEEEDDDVKWA-----EDNDRVSELA
KAFR0J02880        -EGSEYE-------EEEDYNP-YERKTAY-----KDEEDEEVEWA-----EDTDRDTELN
NDAI0I03240        -EDSEYEEEGEE--DEEDYNP-YATRKSY--D----MDKDEVEWA---E-EQTDREAELD
NCAS0E00260        -EDSEYE---------EEYNP-YERKGRY-----SEDKNDEVEWA---E-EQTDRETELD
TPHA0A06000        -EGSEYE--------DESYDP-YKRKSTY----AEESEEEDVKWA-----DDTDRESNVN
Kpol_507.10        -DGSEYEED-----DEEEYDP-YSRKPRY--R--EEEEEEDVKWA---E-ESTNRESQVD
AFR266W            -SD-----------NEDDYDP-HDGRQLY--R----EEADEVKWA---E-DDLDRDAELD
Ecym_2597          -S------------DNDDYDPHHGHKDGF--S----DHDNEVKWA---E-EDLDRDAELE
SAKL0F00814g       -EGGEDD-------DEDDYDP-YYRKNRH--E--EDDDDEEVKWA---ETEDFDRDTGLA
KLTH0G00726g       -QDQEDE-------SEDDYEP-MYKKGKT-------EDEEELKWA---EDEDLDREPELG
Kwal_47.19265      -DDQDEEEE-----SEDDYQP-GYKKDKI--D----EDDEEVKWA---EEDDLDRDPELS
                    .              : *:                              :  :* . : 

KLLA0A00737g       DYNKIQIGRSFVAKFCFYPHFNKIVEGCYGRVNIGKDKHTGNSMYRMVKIERVFL-QKPY
TBLA0E00220        DFNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRH--KPVYRMVKIEKVFLDKRPH
CAGL0H07711g       DFNKIRIGRSFVAKYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVFL-QKPY
ZYRO0E09526g       DFNKAKIGRSFVANFCFYPGFNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVFL-QKPY
TDEL0D06350        DFNKIKIGRSFVAKFCFYPGFNDVVKGHYGRVNVGVDKRSGQTQYRMVKIEKVFF-QKPY
Smik_7.17          DFNKVRIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFL-QKPY
YGL244W            DFNKLRIGRSFVAKFCFYPGFEDAVKGCYGRVNVGTDKRTGKTSYRMVRIERVFL-QKPY
Skud_7.23          DYNKLRIGRSFVAKFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFL-QKPY
Suva_7.17          DFNKLRIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFL-QKPY
KNAG0I00230        DFNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGVDKRSGQTLYRMVKIEKVFL-QKPY
KAFR0J02880        DFNKLRIGRSFVAKFCFYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIFL-QKPY
NDAI0I03240        DFNKVKVGRSFIAKYCFYPGFSDLLKGCYGRVNVGTDRRTGISSYRMVKIEKVFL-KGPY
NCAS0E00260        DFNKVKIGRSFVAKYCFYPGFNELIKGCYGKVNVGTDRRTGTTSYRMVKIEKIFL-QKPY
TPHA0A06000        DFNKIKIGRSFVAKYCFYPGFNDIVKDCYGRVNVGVNKNTNQVMYRMVKIEKVFL-QKPY
Kpol_507.10        DFNKIKIGRSFVARYCFHPDFNEIVKGCYGRVNVGVDRRTNQTAYRMVKIEKVFL-QKPY
AFR266W            DFNKIKVGRSFVAKFCFYPEFNQRVQGCYGRVNIGVDKHTGQAMYRMVKIEKVFL-QKPY
Ecym_2597          DFNKVKIGRSFVAKFCFYPDFAERVQACYGRVNIGLDKHTGLPMYRMVKIERVFL-QKPY
SAKL0F00814g       DFNKVKIGRSFVAKFCFYPGFNELVQNSYGRVNVGIDKHTGQTAYRMVKIEKVFL-QKPY
KLTH0G00726g       DFNRIKIGRSFVAKFCFYPEFNDMIKGCYGRVNVGVDKRSGQTLYRMVKIEKVFL-QKPY
Kwal_47.19265      DFNKVKIGRSFVAKFCFYPEFNDLIRGCYGRVNVGVDKRNNQTLYRMVKIERVFL-QKPY
                   *:*. .:****  .:**:* * . :   *..**:. :..     ****.**.:*: : *:

KLLA0A00737g       NMGKFFTNQYFGVTQGKDRKIFQMSYFSDSPVTQPEYERYLLSLEKYDITQPSPYILNNK
TBLA0E00220        DMGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEHDHITRPSVYAINNK
CAGL0H07711g       NMGKFFTNQYFGVTQGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPYNIKTK
ZYRO0E09526g       NMGKFITNQYFGVTQGKDRKVFQMRYFSDGAITQQEFERYMHALERDHITGPSVYSLENK
TDEL0D06350        NMGNFFTNQYFGVTQGKDRKVFQMNFFSDGNFTQSEYDRYLRALDGVHITKPSMYSLDNK
Smik_7.17          NMGKFYTNQYFGVTQGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLNNK
YGL244W            NMGKFYTNQYFGVTQGKDRKVFQMNYFSDGLFAEDEYQRYLRALDNSQMIKPSLHSLSNK
Skud_7.23          SMGKFYTNQYFGVTQGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLSNK
Suva_7.17          NMGKFFTNQYFGVTQGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHTLSNK
KNAG0I00230        NMGKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEYERYLRSLETANISRPSAHILSNK
KAFR0J02880        SMGKFFTNQYFGVTQGKDRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVYTLKSK
NDAI0I03240        RMGDFFTNQYLGVTQGHDRKVLQMNIFSDGLFTSAEFDRYTRALENSHLTKPSIHVLRGK
NCAS0E00260        RMGEFFTNQYFGVTQGSNRKVFQMNFFSDGLFTPDEFERYVRSLDTSHITKPSIYTLKNK
TPHA0A06000        SMGNFFTNQYFGVTQGKDRKVFQMKFFSDGAITQDEYERYVRALESSNLTIPSTYALSNK
Kpol_507.10        NMGKFFTNQYFGVTQGKDRKVFQMNFFSDGPITIEEFDRYQRSLDASNASKPSVYSLTQK
AFR266W            NMGKFFTNQYFGVTQGKDRKVFQMNFFSDGPILQPEYERYLNQIAKHDINKPSLYTLNNK
Ecym_2597          SMGKFFTNQYFGVTQGKDRKVFQMNYFSDGPITQPEFERYLNQMAKYDMNKPSLYTLNNK
SAKL0F00814g       NMGKFFTNQYFGVTQGKDRKVFQMNFFSDGAITQVEYERYLKSLEKYGINKPSVYNLNNK
KLTH0G00726g       NMGKFFTNQYFGVTQGKNRKVFQMNFFSDGAITQPEFERYLRSLETSEINKPSLYIINNK
Kwal_47.19265      NMGKFFTNQYFGVTQGKDRKVFQMNFFSDGAITQPEFERYMKSLDASGINPPSLYTLNNK
                    **.* *** :***** :**: .*  ***. .   *: **   :       *: : :  *

KLLA0A00737g       SKAVNEFVCEPLTPKLMDDIVRNRMVFNKKLSGTNAVMEKQVLKEKLQFSKQSGDIESES
TBLA0E00220        FKEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGKLQFAKETGNERDVT
CAGL0H07711g       FKEISEFISQPLTEKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGNEHDIA
ZYRO0E09526g       AKEINSFVSQPLTEQLTNDIVRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIA
TDEL0D06350        AKEMNAFVSQPLTDKLTDDIVRNRMLFNKKLSGSNAVLEKTVLKEKLRYAQETGNDRDIA
Smik_7.17          TKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIA
YGL244W            TKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIA
Skud_7.23          TKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIA
Suva_7.17          TKEVIDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIA
KNAG0I00230        SKEIVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAVLEKTVLRSKLQYARESNNERDVA
KAFR0J02880        SKELVSFVSEPLTEKLTNEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNNERDVA
NDAI0I03240        SKEIQAFVSEPLTAKMTDAIVRNRMMFNKKLSGTNAVLEKTVLKDKLRYARENNNERDVA
NCAS0E00260        AKEIQSFISEPLTEQLMDTIVRNRMLFNKKLSGTNAVLEKTVLRDKLRYAQENNNERDVA
TPHA0A06000        FKEVDEFVNEPMTVKLTDEVVRNRMIFNKKLSGTNAVLEKTVLREKLNFAKQNNSERDIA
Kpol_507.10        LKEINEFVSEPMTDKLTDEIVRNRMVFNKKLSGTNAVLEKTVLRGKLQYAKENNNERDIA
AFR266W            AKDLTNFVSQPMTPKLTDQIVRNRMQFNKKLTGTNAVLEKTVLRDKLQYARDTNNEKDIA
Ecym_2597          AKELFNFVSQPMTMKLTDQIVRNRMVFNKKLTGTNAVLEKSVLKDKLQYAKDTNNESAVA
SAKL0F00814g       SKEISEFVSQPMTSKLTDDIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYAKETSNERDIA
KLTH0G00726g       SNEINSFVSQPVTSKLTDELVRNRMIFNKKLSGTNAVLEKTILKDKLQYAKESGSERDVA
Kwal_47.19265      SNEINGFVSQPVTPKLTDELVRNRMLFNKKLSGTNAVLEKTILRDKLQYAKETGSERDVA
                    : :  *   *:* :  : :**:** :****:* ***:** :*. **.:: :. .    :

KLLA0A00737g       KYANQLKALEKRLSSYEKHHENDQNDIKTLGALTSKNRKLNIDRIRHAETIKREEGVN-K
TBLA0E00220        KYSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKARNVEHKKVE-LAG--
CAGL0H07711g       KYSKQLRNFEKRMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEEDVN--
ZYRO0E09526g       KYSSQLRSFEKRMSTYEKQHENDKVGINKLNALTTKNRRVNIDRLKNAEQVKKE-DTS--
TDEL0D06350        KYSSQLRNLVKRMSAYEKHHETDQSGIKKLGALTSKNRKVNMDRIRNAEHIKKE-DVN--
Smik_7.17          KYSAQLRNFEKRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVNN--
YGL244W            KYSAQLRNFEKRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDSNN--
Skud_7.23          KYSAQLRNFEKRMSIYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSN--
Suva_7.17          KYSAQLRNFEKRMSVYEKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDTSN--
KNAG0I00230        KYSAQLRNFEKRMNNYEKHHENDHTGTKKLGALTSKNRKVNMGKTKNYDHGKKEDSAGPT
KAFR0J02880        KYSAQLRNFEKRMNMYEKHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKE-DLP--
NDAI0I03240        KYSSQLRNLEKRMSVYEKHHENDQLGMNKLGALTSKNRKVNMDKIRNAEHIKKE-DHG--
NCAS0E00260        KYSSQLRNLEKRLSVYEKHHENDQVGSNKLGALTSKNRKVNMDKIKNTGHEKKE-EIG--
TPHA0A06000        KYSSQLRNLEKRLMTYEKHHENDQQGAKKLGKLTSKNRKLNMDKIKYGENVKEDRDES--
Kpol_507.10        KYSTQLRNLEKRLSTYEKHHENDQAGARKLGALTSKNRKVNMDKAKNVEHVKEE-DIN--
AFR266W            KYSSQLKNLEKRMSSYEKHHENDQTGIRKLDALTSKNRKVNLDKIRHVENVKKEDSAT--
Ecym_2597          KYAAQLKNLEKRMSSYEKHHENDQTGIRKLGALTSKNRKVNMDKIRLAENVRKEDSSN--
SAKL0F00814g       KYSSQLKNLEKRISSYEKHHENDQAGIKKLGVLTSKNRKLNIDRIKHAELVQKD-DVN--
KLTH0G00726g       KYSSQLRNLEKRLSSYEKHHENDQAGSKKLGALTSKNRRVNLDKGKNVEVTKKE-DTP--
Kwal_47.19265      KYSSQLRSLERRLTSYEKHHENDQAGSKKLGALTSRNRRANMDKGKNVDTTKKE-DTP--
                   **: **. : .*:  ***:**.*: . ..*  **:.*.. *:.. .     . :      

KLLA0A00737g       VDAKSDPFSRLKTRTKIYYQEIQQEENEKAREE--AK-RQLEVDQEAEEQKKKELLLAKF
TBLA0E00220        FDAKADPFSRLKTRTKIYYQEIQKEENEKAQEL--AHKKQLEEDAEAKAQSEKEQLLAEF
CAGL0H07711g       FDSKSDPFSRLKTRTKVYYQEIQKEENEKAKEE--AAQEQLKIDEETKKEKEKQLMLAEF
ZYRO0E09526g       FDSKSDPFSRLKTRTKFYYQEIQKEENEKAKND--AEQKQLEEDESTTERKKHELLSARF
TDEL0D06350        FDAKSDPFSRLKTRTKVYYQEIQKEENERAQDI--ARQKQLDESEEAIARREKELLSSDF
Smik_7.17          FDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEI--AQQEKLQEDKVAKEKREKELLLAQF
YGL244W            FDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEI--AQQEKLQEDKDAKDKREKELLVAQF
Skud_7.23          FDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEI--AQQEKLQEDKEAKDKREKELLLAQF
Suva_7.17          FDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEM--AQQEKLQEDRESKERREKELLLAQF
KNAG0I00230        VDSKSDPFSRLKTRTKIYYQEVQKEENEKAKAL--AQQKEIEKNKEADERKEKELLLAQF
KAFR0J02880        ID-KSDPFSRLKTRTKIYYQEIQKEENERAKAL--AQQKKMEENEEATKRKEKELLLAQF
NDAI0I03240        LDSKSDPFSRLKTRTKIYYQEVQKEENEKAQAMAEAKQKQLQENKALNEHKEKELLLARF
NCAS0E00260        FDSKSDPFSRLKTRTKIYYQEVQQEENEKAKAL--AAEKQLKENNEAQARKENELLLAKF
TPHA0A06000        FDIKTDPFSRLKTRTKVYYQEIQEEENEKAKEL--ARQKKMQENKEAIEQKERELLLAKF
Kpol_507.10        FDSKADPFSRLKTRTKIYYQEVQKEENEKAKEL--AQQKKLEEDREAIAKKERELLLAKF
AFR266W            LNVKTDPFSRLKTRTKIYYQEIQQEENEKAQEL--AKQKQQQDKEEKHDRKQQ--LLAKF
Ecym_2597          VDAKSDPFSRLKTRTKIYYQEIQQEENEKAMEL--AKQKHQEQDKETQENKERQLLLAKF
SAKL0F00814g       FDAKSDPFSRLKTRTKIYYKEVQQQENEKAKEA--ARQKQLEEDKGTATRKENELLLAKF
KLTH0G00726g       FDAKTDPFSRLKTRTKIYYQEIQREENEKAKEL--ARQEQLQKDDLNLVEKERKLLLAKF
Kwal_47.19265      FDAKTDPFSRLKTRTKIYYQEIQKEENEKAKEL--ARIEQLEKGNSDLAEKERKLLLARF
                   .: *:***********.**:*:* :** .*     *     .         :.  : : *

KLLA0A00737g       RRLGGLEEIIGSLDLKLHIDI
TBLA0E00220        KCLGGLEKMVGSLNFKFDFDI
CAGL0H07711g       RRLGGLQKIIGSINVDIKLDI
ZYRO0E09526g       RRLGGLKQVIGTVDFQFSIDI
TDEL0D06350        KRLGGLERVIGQMQLPFTFDV
Smik_7.17          RRLGGLERMIGELDIKFDFKF
YGL244W            RRLGGLERMVGELDIKFDLKF
Skud_7.23          RRLGGLERMIGELDIKFDFKF
Suva_7.17          RRLGGLERMIGELDIKFDFKF
KNAG0I00230        RRLGGLENMISKINVNFDIDL
KAFR0J02880        RRLGGLEKMISGLNIEFDLGI
NDAI0I03240        KRLGGLENLIQNLDINVTFDI
NCAS0E00260        RRLGGLENMINSLNLDVNFDI
TPHA0A06000        RRLGGLESIVHNLDINIKL--
Kpol_507.10        RRLGGLESIISSIDIELSI--
AFR266W            RRLGGLEDALSKLDFRIKLDS
Ecym_2597          RRLGGLEEIVSSIPFKIELGF
SAKL0F00814g       RSLGGLEEIIGGIDLQINVNL
KLTH0G00726g       KNLGGLEDIISNMDFQVSLDV
Kwal_47.19265      KNLGGLEEVVSGIDFKLSIEV
                   . ****:  :  : . . .  

FASTA FORMAT for MUSCLE Version 3.6

>KLLA0A00737g
MSDLDDDLLALAGAGTDEEEEDE-FLSTSKKHASK-ESSGSKRRRIMKDDEDEDEDEDDN
----DEEDDDGYMP------ADSFDNDEEE--EEEEEETDSIPFPLEGKYKDEKDREKLE
LLPEMERESILFERSQQMQKYQERKLLRQHAKSIKQQQQLQ----REGSKSTRASTRSSR
TTGHSDLKQSKLSELKKQRAKK-SGNYEFSDNESEDDYRSEDDSRGRRRRGDYDDEEE--
-EESEYDE------EEDDYDL-GYEKSKT--RGRERADIHEVEWA---EDDNLDRESSLD
DYNKIQIGRSFVAKFCFYPHFNKIVEGCYGRVNIGKDKHTGNSMYRMVKIERVFL-QKPY
NMGKFFTNQYFGVTQGKDRKIFQMSYFSDSPVTQPEYERYLLSLEKYDITQPSPYILNNK
SKAVNEFVCEPLTPKLMDDIVRNRMVFNKKLSGTNAVMEKQVLKEKLQFSKQSGDIESES
KYANQLKALEKRLSSYEKHHENDQNDIKTLGALTSKNRKLNIDRIRHAETIKREEGVN-K
VDAKSDPFSRLKTRTKIYYQEIQQEENEKAREE--AK-RQLEVDQEAEEQKKKELLLAKF
RRLGGLEEIIGSLDLKLHIDI
>TBLA0E00220
MSDIDEDLLALAGADEEEEED---TLMVSSKKRARNNDSSSKRRKIEVDNEDEE------
-------EEDDYNP------VFNEDNNQSTYNTMDGEREEPNPFPLEGKYKDEDDREKIE
SMPEMERETLLFERSQIMQKYQERKMFRERSRKQMSLNNNS----NLTGQKTRTSTRVTH
TTGLSDAKSSKLSQLKRQRERRNKGQSNYSDEDEYEDEY-EDDL-------E-QEYKS--
-SGSDYDENEAAEEEEDDYDL-YGSKTKYNHRGSEEDDDDDVKWA-----EDIDRESNVQ
DFNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRH--KPVYRMVKIEKVFLDKRPH
DMGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEHDHITRPSVYAINNK
FKEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGKLQFAKETGNERDVT
KYSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKARNVEHKKVE-LAG--
FDAKADPFSRLKTRTKIYYQEIQKEENEKAQEL--AHKKQLEEDAEAKAQSEKEQLLAEF
KCLGGLEKMVGSLNFKFDFDI
>CAGL0H07711g
MSDLDEDLLALAGADEEDEEE---VLTTTNKRTKGSSNSQVKKRRIEVDSED--------
-------EEDDYNP--------DDGYEPVDVSDKEEEEEEENPFPLEGKYKDTADRDHLE
SLPEMERETILFERSQVMRKYQERKLFRERGRNLKQQKIQA----GEDSQKTRSSNRSTR
ATGHSDIKASKLSQLKKQRERKSKGRRSSDYEESDEDNYGDEDE----F--K-DDFIE--
-EDSDYKEN---DDDEEGYDP-YARKSKYAQD-NDEEEDEEVEWA-----EQLDRDAEVQ
DFNKIRIGRSFVAKYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVFL-QKPY
NMGKFFTNQYFGVTQGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPYNIKTK
FKEISEFISQPLTEKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGNEHDIA
KYSKQLRNFEKRMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEEDVN--
FDSKSDPFSRLKTRTKVYYQEIQKEENEKAKEE--AAQEQLKIDEETKKEKEKQLMLAEF
RRLGGLQKIIGSINVDIKLDI
>ZYRO0E09526g
MSDIEEDLLALAGADEEEDDDE--VLASSAKRSGKSDRASSKKRRIEVEGGEDDEDE---
-------DEDDYNP-----AASGAGTGDYD----DEEEEEENPFPLEGKYKDEADRDYLG
GLPEMERETMLFERSQIMQKYQDRKMFRQRGKNLKEQQQRS--KQQEEGKKTRSSTRSTV
ATGHSDIKASKLSQLRKQREKK-SQNRPYSDEEEEGED-------------EGDDYGY--
-EDKKYSDEE----DEEEYDP-YSRRSRF--E----EDEDEVQWA---E-EALDREANVA
DFNKAKIGRSFVANFCFYPGFNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVFL-QKPY
NMGKFITNQYFGVTQGKDRKVFQMRYFSDGAITQQEFERYMHALERDHITGPSVYSLENK
AKEINSFVSQPLTEQLTNDIVRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIA
KYSSQLRSFEKRMSTYEKQHENDKVGINKLNALTTKNRRVNIDRLKNAEQVKKE-DTS--
FDSKSDPFSRLKTRTKFYYQEIQKEENEKAKND--AEQKQLEEDESTTERKKHELLSARF
RRLGGLKQVIGTVDFQFSIDI
>TDEL0D06350
MSDIEEDLLALAGADEEEDEDE--VLTTSAKRNKTSDNASSKRRKIAVEGAEEDEDEDED
-------EEDDYNP-----AAVQTESGRYSEEDEEDEEEEENPFPLEGKYKDDNDRAHLE
GLPEMERETLLFERSQIMQKYHDRRLFRERGRNMKEQQKNR---QLREGNKTRSSARTTH
ATGHSDLKASKLSQLRKQREQKGHRANRDRDFEEEEEE---------------EEDRY--
-EGSEYEDE-----DEEDYDP-YNRKSHR--DARKGRRSGMGR-------DQLDREADIT
DFNKIKIGRSFVAKFCFYPGFNDVVKGHYGRVNVGVDKRSGQTQYRMVKIEKVFF-QKPY
NMGNFFTNQYFGVTQGKDRKVFQMNFFSDGNFTQSEYDRYLRALDGVHITKPSMYSLDNK
AKEMNAFVSQPLTDKLTDDIVRNRMLFNKKLSGSNAVLEKTVLKEKLRYAQETGNDRDIA
KYSSQLRNLVKRMSAYEKHHETDQSGIKKLGALTSKNRKVNMDRIRNAEHIKKE-DVN--
FDAKSDPFSRLKTRTKVYYQEIQKEENERAQDI--ARQKQLDESEEAIARREKELLSSDF
KRLGGLERVIGQMQLPFTFDV
>Smik_7.17
MSDLDEDLLALAGADESEEEDQV-LTTTSAKRAKNNDQSLSKKRRIEVGNAEEDDEEDED
-------EEDDYNP-------YSVGNASYG----SEEVEEPNPFPLEGKYKNESDREHLE
SLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRA--KNDEDSRKTRTSTRSTH
ATGHSDIKASKLSQLKKQRARK---NRHYSDNEGEVDD---EDE----YRED-DYKDD--
-EGSEYG-------DDEEYNP-FDRGDLY--D----KREEEVEWAEE-E-DELDREPEIS
DFNKVRIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFL-QKPY
NMGKFYTNQYFGVTQGKDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLNNK
TKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIA
KYSAQLRNFEKRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVNN--
FDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEI--AQQEKLQEDKVAKEKREKELLLAQF
RRLGGLERMIGELDIKFDFKF
>YGL244W
MSDLDEDLLALAGADESEEEDQV-LTTTSAKRAKNNDQSLSKKRRIEVGSVEDDD-----
-------EEDDYNP-------YSVGNADYG----SEEEEEANPFPLEGKYKDESDREHLE
SLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRA--KNDEDSRKTRASTRSTH
ATGHSDIKASKLSQLKKQRARK---NRHYSDNEDEDDE----ED----YREE-DYKDD--
-EGSEYG-------DDEEYNP-FDRRDTY--D----KR-EEVEWAEE-E-DEQDREPEIS
DFNKLRIGRSFVAKFCFYPGFEDAVKGCYGRVNVGTDKRTGKTSYRMVRIERVFL-QKPY
NMGKFYTNQYFGVTQGKDRKVFQMNYFSDGLFAEDEYQRYLRALDNSQMIKPSLHSLSNK
TKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIA
KYSAQLRNFEKRMSVYEKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDSNN--
FDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEI--AQQEKLQEDKDAKDKREKELLVAQF
RRLGGLERMVGELDIKFDLKF
>Skud_7.23
MSDLDEDLLALAGADESEEEDQV-LTSTSAKRAKNNDQSVSKKRRIEVDSAEEEDEEDE-
-------EEDDYNP-------YSVGNAGYG-----SEGEEANPFPLEGKFKDENDREHLE
SLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRA--KDKEDSRKTRTSTRSTH
ATGHSDIKASKLSQLKKQRARK---NRQYSDNEDEEDD---EDE----YRED-NYKNE--
-EESEYE-------DDEEYNP-FDRKDLY--D----KREEEVEWAEEGE-DELDREPEIS
DYNKLRIGRSFVAKFCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFL-QKPY
SMGKFYTNQYFGVTQGKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLSNK
TKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIA
KYSAQLRNFEKRMSIYEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSN--
FDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEI--AQQEKLQEDKEAKDKREKELLLAQF
RRLGGLERMIGELDIKFDFKF
>Suva_7.17
MSDLDEDLLALAGADESEEEDQV-LTSTSAKRAKNNDQSISKKRRIEVGSAEEEEEEDE-
-------EEDDYNP-------YSVGNTGYG--SEEEEEVEPNPFPLEGKYKDESDREHLE
SLPEMERETLLFERSQIMQKYQERKLFRARGKDMKEQQQRKRARDDEDSRKTRTSTRSTH
ATGHSDIKASKLSQLKKQRARK---NRQYSDSEDEQDD---QEE----YRED-DYKND--
-EGSEYG-------DDEEYNP-FDRKGVY--D----KREEEVEWAEEEE-DELDRDPEIS
DFNKLRIGRSFVAKFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFL-QKPY
NMGKFFTNQYFGVTQGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHTLSNK
TKEVIDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIA
KYSAQLRNFEKRMSVYEKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDTSN--
FDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEM--AQQEKLQEDRESKERREKELLLAQF
RRLGGLERMIGELDIKFDFKF
>KNAG0I00230
MSDIDEDLLALAGADEEEDDERV-LTSTVSKRSKQSDATASKKRRIYEGSEEEVYDDEAD
---DVDEEEDDYNP-------HEVGNYDTG--DDEAENEEQNPFPLQGKYKDEKDREYLE
SLPEVERETVLFDRSQTMRKYQERKLFRERKR-------------QQEAKPTRSSGRTAH
STGHSDLKASKLSQLKRQRDKKLNRQRSDDEYEEDEEE--EEED-------DYNGYGDDL
NEDAEYQEDE----DEEDYNP-LAIKSKY--DELEEEEDDDVKWA-----EDNDRVSELA
DFNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGVDKRSGQTLYRMVKIEKVFL-QKPY
NMGKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEYERYLRSLETANISRPSAHILSNK
SKEIVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAVLEKTVLRSKLQYARESNNERDVA
KYSAQLRNFEKRMNNYEKHHENDHTGTKKLGALTSKNRKVNMGKTKNYDHGKKEDSAGPT
VDSKSDPFSRLKTRTKIYYQEVQKEENEKAKAL--AQQKEIEKNKEADERKEKELLLAQF
RRLGGLENMISKINVNFDIDL
>KAFR0J02880
MSDIDEDLLALAGADEEEEEE---VLTTSKRTKQSGDSSANKKRRIESDSDE--------
-------DEDDYNP-----AAIDGGDGAYNE-NDDEEEYEENPFPLEGKYKNEEDRDYLE
SLPEMERETVLYDRSQTMRKYRERQFFKDRNKNLKRQKERN---EDDEALKTRSSGRATH
ATGHTDLKASKLSQLKKQREKK-NKSRQYSDYEEEEEE--DEEE----F--E-DEYR---
-EGSEYE-------EEEDYNP-YERKTAY-----KDEEDEEVEWA-----EDTDRDTELN
DFNKLRIGRSFVAKFCFYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIFL-QKPY
SMGKFFTNQYFGVTQGKDRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVYTLKSK
SKELVSFVSEPLTEKLTNEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNNERDVA
KYSAQLRNFEKRMNMYEKHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKE-DLP--
ID-KSDPFSRLKTRTKIYYQEIQKEENERAKAL--AQQKKMEENEEATKRKEKELLLAQF
RRLGGLEKMISGLNIEFDLGI
>NDAI0I03240
MSDIDEDLLALAGADEEEEDDEQ-LLTTSGKRAKNHDQVGSKRKKIEVDSEAEEE-----
-------EEDDYNP--------YGGNQ-----SEEEEIDEPNPFPLENKYKDEDDREHLE
SLPEMERETLLFERSQVMRKYQERKLFRERQRNIKEQQERN--ELEEEGKKTRSSTRATH
ATGHSDLKASKLSQLKKQRERK-TRDQDYNDVEDEDDL----DD----YAPD-DNYKH--
-EDSEYEEEGEE--DEEDYNP-YATRKSY--D----MDKDEVEWA---E-EQTDREAELD
DFNKVKVGRSFIAKYCFYPGFSDLLKGCYGRVNVGTDRRTGISSYRMVKIEKVFL-KGPY
RMGDFFTNQYLGVTQGHDRKVLQMNIFSDGLFTSAEFDRYTRALENSHLTKPSIHVLRGK
SKEIQAFVSEPLTAKMTDAIVRNRMMFNKKLSGTNAVLEKTVLKDKLRYARENNNERDVA
KYSSQLRNLEKRMSVYEKHHENDQLGMNKLGALTSKNRKVNMDKIRNAEHIKKE-DHG--
LDSKSDPFSRLKTRTKIYYQEVQKEENEKAQAMAEAKQKQLQENKALNEHKEKELLLARF
KRLGGLENLIQNLDINVTFDI
>NCAS0E00260
MSDLDEDLLALAGADEEEEDEQV--LTTSNKRAKNHEHASSKRKKIEVDSEAE-------
-------EEDDYDP----------GNFGAGNISEEEEEMEQNPFPLEGKYKDEADREQLE
SLPEMERETLLFERSQTMRKYQERKLFRERQRNLKEQQQRN--APSEEGTKTRTSTRTTH
ATGHSDLKASKLSQLKKQRERKGLHRRGSDEEGSEFEE--EEEE----YDEE-EYKKD--
-EDSEYE---------EEYNP-YERKGRY-----SEDKNDEVEWA---E-EQTDRETELD
DFNKVKIGRSFVAKYCFYPGFNELIKGCYGKVNVGTDRRTGTTSYRMVKIEKIFL-QKPY
RMGEFFTNQYFGVTQGSNRKVFQMNFFSDGLFTPDEFERYVRSLDTSHITKPSIYTLKNK
AKEIQSFISEPLTEQLMDTIVRNRMLFNKKLSGTNAVLEKTVLRDKLRYAQENNNERDVA
KYSSQLRNLEKRLSVYEKHHENDQVGSNKLGALTSKNRKVNMDKIKNTGHEKKE-EIG--
FDSKSDPFSRLKTRTKIYYQEVQQEENEKAKAL--AAEKQLKENNEAQARKENELLLAKF
RRLGGLENMINSLNLDVNFDI
>TPHA0A06000
MSDIEEDLLALAGVGDSEEEEDV-VISSTSKRGRSNEDSVSKKRHINVGED---------
-------DEDDYNP-------ASAGLGD----DDDNDDEEEAPFPLEGKYRDERDRDYLE
SLPEMERETLLFERSQLMQKYKDRMLFRERQRTLKRQRESS------ENRKVRSSTRSSK
VTGHSDVKSSKLSQLKKQRERKNNHHYSDEDDEDEYEE--EENI----Y--E-DKYE---
-EGSEYE--------DESYDP-YKRKSTY----AEESEEEDVKWA-----DDTDRESNVN
DFNKIKIGRSFVAKYCFYPGFNDIVKDCYGRVNVGVNKNTNQVMYRMVKIEKVFL-QKPY
SMGNFFTNQYFGVTQGKDRKVFQMKFFSDGAITQDEYERYVRALESSNLTIPSTYALSNK
FKEVDEFVNEPMTVKLTDEVVRNRMIFNKKLSGTNAVLEKTVLREKLNFAKQNNSERDIA
KYSSQLRNLEKRLMTYEKHHENDQQGAKKLGKLTSKNRKLNMDKIKYGENVKEDRDES--
FDIKTDPFSRLKTRTKVYYQEIQEEENEKAKEL--ARQKKMQENKEAIEQKERELLLAKF
RRLGGLESIVHNLDINIKL--
>Kpol_507.10
------------------------------------------------------------
------------------------------------------------------------
----MERETLLFERSQLMQKYQDRKLFRERQRNLKRQQRNN--TSAQEGKKTRTSTRSTQ
ATGHSDVKASKLSQLKRQREKNKNRQYSESEGEYEEEE--DEDD----Y--D-TGYKY--
-DGSEYEED-----DEEEYDP-YSRKPRY--R--EEEEEEDVKWA---E-ESTNRESQVD
DFNKIKIGRSFVARYCFHPDFNEIVKGCYGRVNVGVDRRTNQTAYRMVKIEKVFL-QKPY
NMGKFFTNQYFGVTQGKDRKVFQMNFFSDGPITIEEFDRYQRSLDASNASKPSVYSLTQK
LKEINEFVSEPMTDKLTDEIVRNRMVFNKKLSGTNAVLEKTVLRGKLQYAKENNNERDIA
KYSTQLRNLEKRLSTYEKHHENDQAGARKLGALTSKNRKVNMDKAKNVEHVKEE-DIN--
FDSKADPFSRLKTRTKIYYQEVQKEENEKAKEL--AQQKKLEEDREAIAKKERELLLAKF
RRLGGLESIISSIDIELSI--
>AFR266W
MSDLDEDLLALAAGEDGDDGDED-FGV-TSQKRSKHDSSGSKKRRVMDEESGDDEDNDND
AGDEEDEDEDDYNP-----GTEYGFDEGHE--ASEDEVEEENPYPLLGKYRDDADREHIE
NMPEMERETLLFERSQEMQKYQERKVLRERAKNIRAQQQRR---QQKDGSALRSSGRSTR
TTGHSDLRDSKLSELRKQRAKK-SGNYDYSAGEDDSDH-------------S-DDYVD--
-SD-----------NEDDYDP-HDGRQLY--R----EEADEVKWA---E-DDLDRDAELD
DFNKIKVGRSFVAKFCFYPEFNQRVQGCYGRVNIGVDKHTGQAMYRMVKIEKVFL-QKPY
NMGKFFTNQYFGVTQGKDRKVFQMNFFSDGPILQPEYERYLNQIAKHDINKPSLYTLNNK
AKDLTNFVSQPMTPKLTDQIVRNRMQFNKKLTGTNAVLEKTVLRDKLQYARDTNNEKDIA
KYSSQLKNLEKRMSSYEKHHENDQTGIRKLDALTSKNRKVNLDKIRHVENVKKEDSAT--
LNVKTDPFSRLKTRTKIYYQEIQQEENEKAQEL--AKQKQQQDKEEKHDRKQQ--LLAKF
RRLGGLEDALSKLDFRIKLDS
>Ecym_2597
MSDLDEDLLALAEGDDGDEDVMV-----SSKKRSKNDIAGSKKRMLMDDDDEDDSNDDED
NDVEDSEGEDDYNP---GTQYDFEGNDD----GSGDEQEERNPYPLEGKYKDEEDRNRIQ
DMPEMERETLLFERSQEMQKYQERKVLRQRAKSIRAQQQQR--QLQKDSTK-RSSGRSTR
TTGHSELRTSKLSELRKQRAKK-SGNYDYSESEEDESD-------------QSDNYAE--
-S------------DNDDYDPHHGHKDGF--S----DHDNEVKWA---E-EDLDRDAELE
DFNKVKIGRSFVAKFCFYPDFAERVQACYGRVNIGLDKHTGLPMYRMVKIERVFL-QKPY
SMGKFFTNQYFGVTQGKDRKVFQMNYFSDGPITQPEFERYLNQMAKYDMNKPSLYTLNNK
AKELFNFVSQPMTMKLTDQIVRNRMVFNKKLTGTNAVLEKSVLKDKLQYAKDTNNESAVA
KYAAQLKNLEKRMSSYEKHHENDQTGIRKLGALTSKNRKVNMDKIRLAENVRKEDSSN--
VDAKSDPFSRLKTRTKIYYQEIQQEENEKAMEL--AKQKHQEQDKETQENKERQLLLAKF
RRLGGLEEIVSSIPFKIELGF
>SAKL0F00814g
MSDIDEDLLALAGAGSDEEEEEE-VKLASSKKRSQPENAPTKKRRIMDDDDDEGISNEDD
----D--DEDSYHPGGLKEDATHGYEEGEE--EGEEEEEEDNPFPLEGKYKDEQDRTQLE
SLPEMERESLLFERSQIMQQYQERRFLKQRAKNIRDQQQKR--QQQQEGKQVRSSTRTTR
ATGHSDVKTSKLSELKKQRAKK-SGTYDYSEDEEGDGD--DHKY---------DDYYD--
-EGGEDD-------DEDDYDP-YYRKNRH--E--EDDDDEEVKWA---ETEDFDRDTGLA
DFNKVKIGRSFVAKFCFYPGFNELVQNSYGRVNVGIDKHTGQTAYRMVKIEKVFL-QKPY
NMGKFFTNQYFGVTQGKDRKVFQMNFFSDGAITQVEYERYLKSLEKYGINKPSVYNLNNK
SKEISEFVSQPMTSKLTDDIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYAKETSNERDIA
KYSSQLKNLEKRISSYEKHHENDQAGIKKLGVLTSKNRKLNIDRIKHAELVQKD-DVN--
FDAKSDPFSRLKTRTKIYYKEVQQQENEKAKEA--ARQKQLEEDKGTATRKENELLLAKF
RSLGGLEEIIGGIDLQINVNL
>KLTH0G00726g
MSDIDEDLLALAGASSGEEEEED-VQIGSSKKRSRSDHQSSSKRRIVDEDEEQDDDEEEG
-------EEDDYNP----------EAASYDMDSEEDEDEEPNPFPLEGKYKNEEDRSYLE
SLPEMERETMLFERSQTMQKYQERRVLKERAKNIRDQQQKR--QLQQEGKKTRSSTRSTR
TTGHSDLKESRLSELKKQRAKK-KGTYEYSEEEEEEGQ--NEE----------DEYGY--
-QDQEDE-------SEDDYEP-MYKKGKT-------EDEEELKWA---EDEDLDREPELG
DFNRIKIGRSFVAKFCFYPEFNDMIKGCYGRVNVGVDKRSGQTLYRMVKIEKVFL-QKPY
NMGKFFTNQYFGVTQGKNRKVFQMNFFSDGAITQPEFERYLRSLETSEINKPSLYIINNK
SNEINSFVSQPVTSKLTDELVRNRMIFNKKLSGTNAVLEKTILKDKLQYAKESGSERDVA
KYSSQLRNLEKRLSSYEKHHENDQAGSKKLGALTSKNRRVNLDKGKNVEVTKKE-DTP--
FDAKTDPFSRLKTRTKIYYQEIQREENEKAKEL--ARQEQLQKDDLNLVEKERKLLLAKF
KNLGGLEDIISNMDFQVSLDV
>Kwal_47.19265
MSDIDEDLLALAGASSGEEEEEEGVNVGVSKKRSRSSQNASNKRRIVDEDEEIDEDDD--
-------DQDDYNP----ERGIYGDASGAE--DEEDEEEEENPFPLEGKYKDERDREYLE
SLPEMERETLLFDRSQEMQKYRERRVLKERARNIRAQQQKR--QLQQESTKTRSSTRSTR
TTGHSDLKESRLSELKKQRAKK-SGTYDYSEDEDDGGR--DEE----------DDYGY--
-DDQDEEEE-----SEDDYQP-GYKKDKI--D----EDDEEVKWA---EEDDLDRDPELS
DFNKVKIGRSFVAKFCFYPEFNDLIRGCYGRVNVGVDKRNNQTLYRMVKIERVFL-QKPY
NMGKFFTNQYFGVTQGKDRKVFQMNFFSDGAITQPEFERYMKSLDASGINPPSLYTLNNK
SNEINGFVSQPVTPKLTDELVRNRMLFNKKLSGTNAVLEKTILRDKLQYAKETGSERDVA
KYSSQLRSLERRLTSYEKHHENDQAGSKKLGALTSRNRRANMDKGKNVDTTKKE-DTP--
FDAKTDPFSRLKTRTKIYYQEIQKEENEKAKEL--ARIEQLEKGNSDLAEKERKLLLARF
KNLGGLEEVVSGIDFKLSIEV