MUSCLE (3.8) multiple sequence alignment

ZYRO0E09570g       -MV-NLVINGKAPVVAYAELIASRIVNAAHKD-AITVEFVDEKNAAPVVFNGSSDDTFAK
AFR264W            MSS-TLIIAAKSPAVAYAELIAARAVNEAKQD-AVAIQFTEGKEAAAASFDGESQNALER
TBLA0E00190        MST-KLILSGKAQAVAYGELIAARIVNNSSAN-AVDISFVEDKKAAPATLDGSSDDVLAK
KLLA0A00682g       MSA-SLIIGAKAPVIAYPELIAARKVNASKGDNTIEISFVEDKKAAAASFNGETEDVLTK
KLTH0G00682g       -MA-KLIIASKAPVVAYSELIAARLVNSAKTD-AIEIEFVEDKKSSPATFEDSCDDVLKR
Kwal_47.19272      -MA-KLTLASKAPVVAYSELIAARLTNAVKPG-TIEIDFVEDKKASPATFEGNSNDVLKT
SAKL0F00748g       MSA-NLVINGKAPVVAYAELIAARIVNASKAD-AIKIEFVDDKKAAPATFNGEADSAFSK
KNAG0I00220        MSAATLVINGKAPIVAYGPLIAARIANSAKSS-SVAIEFVDDKNAAPAVFNGDSEDVLSK
TDEL0D06370        -MA-KLIINGKAPVVAYAELIAARVVNTVNPE-SINVEFVDDKKAAPAVLDGESEGVFMK
TPHA0A06020        MPA-TLIIGGKSSVVAYSELIAARIVNSVKPD-SITIEFVEDKKAAAASLNGETDDVLSK
Kpol_507.8         MSA-TLVIGGKAPVVAYAELIAARIVNSSKPD-SIKIEFVEDKKASPATLNGDSVDVLSK
CAGL0C01947g       MSS-TLVINGKAPVVAYAELIAARLVNDSKSDASVTVEFVDDKKSAAATFDGKSDNALEA
KAFR0J02890        MSA-TLVINGKAPVVAYDSLIAARLVNAARPD-AIKIEFVDDKKSAPATFNGSSEGSFNK
Suva_7.16          MPS-TLTINGKAPAVAYAELIAARIVNALAPN-SIAVEFVDDKKAPAAKLDDATEDVFNK
Skud_7.22          MPS-TLTVNGKAPSVAYAELIAARIVNALAPN-SIAIQFVDDKKAPAAKLDDATEGVFNK
Smik_7.16          MPS-TLTINGKAPIVAYAELIAARIVNALAPN-SIAIVFVDDKKAPAAILDDATEDVFSK
YGL245W            MPS-TLTINGKAPIVAYAELIAARIVNALAPN-SIAIKLVDDKKAPAAKLDDATEDVFNK
NDAI0I03250        MSANTLVINGKAPVVAYGDLIAARIINDAKPT-SIDIQFVDDKKSAPSVFNGSSDSTFLK
NCAS0E00250        MSA-TLVINGKAPVVAYAELIAARIVNETKPN-SISIEFVDDKKAAPATFNGDNKDAFLK
                       .* : .*:  :**  ***:*  *      :: : :.: *::..  ::.   . :  

ZYRO0E09570g       IISTYPDVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKIS
AFR264W            MVEKYPDVLGSVP-EEAAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPT
TBLA0E00190        IVALSPSSFASASKEDVAHWTKLAQEKLVVKNFQQLAQTLEILDAQLNLRSFVLGGLNFS
KLLA0A00682g       LSAAYPDILNDNS-DSSAEWIEFGAKQLVIKNFQQLAESLAKLNAHLNLRTYILNTLEPS
KLTH0G00682g       IVQTYPEVFKHGF-ENCDEWAKLASEELTVKNFQKLSVSLAKLDACLNFRTFILGGTTFS
Kwal_47.19272      IVESFPEAFKGGF-DGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYS
SAKL0F00748g       IINAYQDVFSEGV-QGSSEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTAT
KNAG0I00220        IAAQFPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYS
TDEL0D06370        IIEAFPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYS
TPHA0A06020        IVSANADVFPEGV-TGSEEWVKLAVSELVIKNFQKLATSLDKLDAHLNLRTFINGGLSYS
Kpol_507.8         IVTANSDVFPEGA-ANSTEWIKIASEELVVKNFQQLNKSLEKLDAHLNLRTYINGGLNFT
CAGL0C01947g       IVAKFPEILGAN--EESKPWIKLAAEELVIKNFQKLAQSLEKLDAQLNFRTYINGGLKFD
KAFR0J02890        IVAAFPDAFRNA--NVASEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYS
Suva_7.16          ITGKFAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYS
Skud_7.22          ITGKFAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYS
Smik_7.16          ITGKFAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYS
YGL245W            ITSKFAAIFDNGDKEQVAKWVNLAQKELVIKNFAKLSQSLETLDSQLNLRTFILGGLKYS
NDAI0I03250        IIEGFPEIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYS
NCAS0E00250        IVAQFSDVFSNSKEEDITQWVKMASEELVIKNFQKLSESLGKLDAHLNLRTFILGGLKYS
                   :       :          *   .  .  :*:* :*  :*  *:: **.*::: .     

ZYRO0E09570g       AADIVCWGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVT
AFR264W            VADVAVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGN
TBLA0E00190        AADVAVWGALRSNGMVGSIIKNKVYVNVSRWYSFLELEPAFGESHEFLTKSLQELKKAAN
KLLA0A00682g       LADIAVWGYLRSNGMVGSIIKNKVYINVSRWYSTFELIPEFGQAHEFLTKSLQELKKASN
KLTH0G00682g       AADIACWGSLRSNGMVGSIIKNKVYVNVSRWYTLLEQIPEFGSAHEFLVKTLQELKKAST
Kwal_47.19272      PADIACWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKAST
SAKL0F00748g       PADIACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASN
KNAG0I00220        VADIACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKAST
TDEL0D06370        AADIACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASN
TPHA0A06020        IADIACWGALRSNGMVGSIIKNKVNVNVSRWYTLFESNPIFGEANEFLTKSLQELKKASS
Kpol_507.8         VADIACWGALRSNGMVGSIIKNKVNVNVSRWYTLLEENTLFGGVHEFLTKSLQELKKAST
CAGL0C01947g       SADIACWGALRSNGMVGSIIKNKVYVNVSRWYLLLESNPSFGQSHEFLTKSLQELKKAAN
KAFR0J02890        AADIAAWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNAS
Suva_7.16          AADVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNAN
Skud_7.22          AADVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSAN
Smik_7.16          AADVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSAN
YGL245W            AADVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLLELKKSAN
NDAI0I03250        AADIACWGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSN
NCAS0E00250        AADIACWGALRSNGMCGSIIKNKVEVNVSRWYTLLEMDPIFGSVHEFLTKSLQELKKTAN
                    **:. ** *****  ***:**.* :******  :*    *.  :: * *::  :*   .

ZYRO0E09570g       AGKKKEGHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLII
AFR264W            VNKKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLII
TBLA0E00190        AGKKKESHKANFEIDLQDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLII
KLLA0A00682g       VNKKKETHKANFEIGLPDAKVGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLII
KLTH0G00682g       SNKKKETHKANFEIDLQDAKVGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLII
Kwal_47.19272      GNKKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLII
SAKL0F00748g       SNKKKETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLII
KNAG0I00220        AGKKKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLII
TDEL0D06370        VGKKKEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLII
TPHA0A06020        AGKKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFADAYKGKLII
Kpol_507.8         AGKKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLII
CAGL0C01947g       AGKKKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLII
KAFR0J02890        AGKKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLII
Suva_7.16          VGKKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMII
Skud_7.22          VGKKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLII
Smik_7.16          VGKKKETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLII
YGL245W            VGKKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLII
NDAI0I03250        SGKKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLII
NCAS0E00250        AGKKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLII
                    .**** *******.* :**:*:*********************:**:***  ****:**

ZYRO0E09570g       RFDDTNPSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDT
AFR264W            RFDDTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDT
TBLA0E00190        RFDDTNPSKEKEEFEESIIEDLALLGIKGDRVTHSSDYFQEMYDYCIQMIKEGKAYCDDT
KLLA0A00682g       RFDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKEGKAYCDDT
KLTH0G00682g       RFDDTNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVKMIEEGNAYCDDT
Kwal_47.19272      RFDDTNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDT
SAKL0F00748g       RFDDTNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDT
KNAG0I00220        RFDDTNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDT
TDEL0D06370        RFDDTNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDT
TPHA0A06020        RFDDTNPSKEKVEFQESILEDLALLGIKGDRITHSSDYFQEMYDYCIQLIKEGKAYCDDT
Kpol_507.8         RFDDTNPSKENVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQLIKDGKAYCDDT
CAGL0C01947g       RFDDTNPSKEKTEFQDSILEDLELLGIKGDRITYSSDYFQEMYELCVKLIKEGKAYCDDT
KAFR0J02890        RFDDTNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDT
Suva_7.16          RFDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDT
Skud_7.22          RFDDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDT
Smik_7.16          RFDDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDT
YGL245W            RFDDTNPSKEKEEFQDSILEDLDLLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDT
NDAI0I03250        RFDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDT
NCAS0E00250        RFDDTNPSKEKEEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCIQMIKEGKAYCDDT
                   **********. **:::*:*** *:**:**.:*.*****::*:: *:::*::* ******

ZYRO0E09570g       DVEKMREERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRD
AFR264W            PTERMREERMEGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKD
TBLA0E00190        PTEKMREERMEGEPSARRNRSVEENLKIFTEDMTNGTEEGLKNCVRAKIDYKALNKTLRD
KLLA0A00682g       PTERMREERTEGIPSSRRERTVEENLKIFTEEMKNGTEEGLKNCVRAKIDYEALNKAMRD
KLTH0G00682g       PTDKMREERMDGLASARRDRSVEENLRIFTQEMKNGTEEGLKNCVRAKIDYKALNKTLRD
Kwal_47.19272      ATERMREERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRD
SAKL0F00748g       PTEKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRD
KNAG0I00220        PTEKMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRD
TDEL0D06370        VTEKMREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRD
TPHA0A06020        PVDKMREERMDGIASARRNRSVEENLKIFTEEMQNGTEEGLQNCVRAKIDYEALNKTLRD
Kpol_507.8         PTEKMRDERMNGIASVRRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRD
CAGL0C01947g       PTEKMREERMDGIASARRERSVEENLKIFTEDMKNGTEEGLKNCVRAKIDYAALNKTLRD
KAFR0J02890        PTEKMREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRD
Suva_7.16          PTEKMREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRD
Skud_7.22          PTERMREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRD
Smik_7.16          PTEKMREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRD
YGL245W            PTEKMREERMDGVASARRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRD
NDAI0I03250        PTEKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRD
NCAS0E00250        PTEKMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRD
                    .:.**:** :* .* .*: .*****.:*. :* **** * :****** ** * **::.*

ZYRO0E09570g       PVIYRCNLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKAL
AFR264W            PVLYRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNAL
TBLA0E00190        PVIYRCNLTPHHITGDKWKVYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYEWMLDAL
KLLA0A00682g       PVIYRCNLTPHHRTGTAWKIYPTYDFCVPIVDSLEGVTHALRTIEYRDRNPQYDWMLNAL
KLTH0G00682g       PVIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYQWMLDAL
Kwal_47.19272      PVIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNAL
SAKL0F00748g       PVIFRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDAL
KNAG0I00220        PVIYRCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNAL
TDEL0D06370        PVIYRCNLTPHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAM
TPHA0A06020        PVIYRCNLNPHHRTGTAWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYEWMLNAM
Kpol_507.8         PVIFRCNLTPHHRTGSQWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNAL
CAGL0C01947g       PVIYRCNLTPHHRTGSEWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWFLDNL
KAFR0J02890        PVIYRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNAL
Suva_7.16          PVIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQAL
Skud_7.22          PVIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQAL
Smik_7.16          PVIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQAL
YGL245W            PVIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNAQYDWMLQAL
NDAI0I03250        PVIYRCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAM
NCAS0E00250        PVIYRCNLTPHHRTGTTWKVYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLQAL
                   **::****.*** *    * *********:**::**************** **:*:*. :

ZYRO0E09570g       RLRKVHIWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTVRGVRRRGMTVEGLRN
AFR264W            KLRKVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRN
TBLA0E00190        KLRHVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMSIEGLRN
KLLA0A00682g       HLRKVHIWDFARVNFVRTLLSKRKLQWLVDKDIVSNWDDPRFPTVRGVRRRGMTIEGLRN
KLTH0G00682g       HLRKVHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTVRGVRRRGMTVEGLRN
Kwal_47.19272      HLRKVHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTVRGVRRRGMTVEGLRN
SAKL0F00748g       HLRKVHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTVRGVRRRGMTVEGLRN
KNAG0I00220        HLRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTVRGVRRRGMTVEGLRN
TDEL0D06370        NLRKVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTVRGVRRRGMTVEGLRN
TPHA0A06020        NLRKVHIWDFARVNFVRTLLSKRKLQWMVDKELVSNWDDPRFPTVRGVRRRGMTIEGLRN
Kpol_507.8         KLRKVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWEDPRFPTVRGVRRRGMTVEGLRN
CAGL0C01947g       NLRKVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTVRGVRRRGMTVEGLRN
KAFR0J02890        HLRKVHIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTVRGVRRRGMTVEGLRN
Suva_7.16          RLRKVHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTVRGVRRRGMTVEGLRN
Skud_7.22          RLRKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRN
Smik_7.16          RLRKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRN
YGL245W            RLRKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRN
NDAI0I03250        NLRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMTVEGLRN
NCAS0E00250        NLRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMTVEGLRN
                   .**:********:**:***********:**:  * **:***************::*****

ZYRO0E09570g       FVISQGPSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKP
AFR264W            FVLSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKP
TBLA0E00190        FVLSQGPSRNVINLEWNLIWAFNKKVIDPTAPRHTAVVNPFKVHLEGSEVPQTDKIEMKP
KLLA0A00682g       FVLSQGPSRNVINLEWNLIWSFNKKVIDPVAPRHTAIVSPVKVHLEGDDVPQTPNVEMKL
KLTH0G00682g       FVLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVKPVKFHVEG--APQTPDVQIKL
Kwal_47.19272      FVLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDG--APQTPDVQMKL
SAKL0F00748g       FVLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKL
KNAG0I00220        FVLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEG--APETPKTEMKP
TDEL0D06370        FVLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKP
TPHA0A06020        FVISQGPSRNVINLEWNLIWAFNKKVIDPVAPRLTCVINPIKIHLSGADAPETPRVEMKP
Kpol_507.8         FVLSQGPSRNVINLEWNLIWSFNKKVIDPVCPRLTAVVDPVKIHLEGEDAPQSAKVEMKP
CAGL0C01947g       FVLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVNPVKIHIEG--APESPKTEMKP
KAFR0J02890        FVLSQGPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKP
Suva_7.16          FVLSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKP
Skud_7.22          FVLSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKP
Smik_7.16          FVLSQGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQEPKTETKP
YGL245W            FVLSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGSEAPQEPKIEMKP
NDAI0I03250        FVLSQGPSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKP
NCAS0E00250        FVLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVNPVKIHLEGDDVPQTPKIEMKP
                   **:*****.********:**:.***:*** ..* * : .*.:. : *  .*:    : * 

ZYRO0E09570g       KHKKNPAVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNL
AFR264W            KHKKNPAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNL
TBLA0E00190        KHKKNPDVGEKKVVFSKNIIIDKEDADVLEEGEEFTLMDWGNAIITKKDAN-SITAKLHL
KLLA0A00682g       KHKKNPAIGEKKVIYYKDIVIDEEDAKLLSEGEEVTLMDWGNAIITKKNDDGSFNAKLHL
KLTH0G00682g       KHKKNPAVGEKKVIYYADILIDQDDADAVTEGEELTLMDWGNAIVTKKNADGSLTGKLHL
Kwal_47.19272      KHKKNPAVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHL
SAKL0F00748g       KHKKNPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHL
KNAG0I00220        KHKKNPAVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHL
TDEL0D06370        KHKKNPDVGEKKVIFYKDVVIDKDDADVLEDNEEVTLMDWGNVIITKKNADGSLEGKLNL
TPHA0A06020        KHPKNPAVGEKRVIFSKDIVIDKDDADVIEEGEEITLMNWGNAIIDKKNADGSIDATLHL
Kpol_507.8         KHPKNPVVGEKKVVFYKDIVIDREDADSIEDGEEITLMNWGNAIITKKNADGSLNAKLHL
CAGL0C01947g       KHKKNPAVGEKKVIYYQNVVIDKEDADSIEDNEEVTLMDWGNIIITKKNADGSMEAKLHL
KAFR0J02890        KHKKNPAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHL
Suva_7.16          KHKKNPAVGEKKVIYYKDIVVDKDDADVIDVDEEVTLMDWGNVVITKKNADGSMVAKLHL
Skud_7.22          KHKKNPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHL
Smik_7.16          KHKKNPAVGEKKVIYYKDIVVDKDDADVINVDEEITLMDWGNVIITKKNEDGSMIAKLNL
YGL245W            KHKKNPAVGEKKVIYYKDIVVDKDDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLNL
NDAI0I03250        KHKKNPAVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHL
NCAS0E00250        KHKKNPAVGEKKVIYFKDIVIDKDDADLLEANEEVTMMDWGNVIITQKNADGSLVGKLHL
                   ** *** :***.:::  .:::.  **  :  .**.*:*:*** ::  .  : *: .  :*

ZYRO0E09570g       GGDFKKTKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGD
AFR264W            EGDFKKTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIAD
TBLA0E00190        EGDFKKTKHKITWLADTKDVVSVDLVDFDHLLNKDRIEEGESFEDFLTEKTEFHTSAIAD
KLLA0A00682g       EGDFKTTKFKLTWLADTDDKVEADLVDFDHLISKDKLEEGENFEDFLTPKTEFHTTAYAD
KLTH0G00682g       EGDFKKTKLKLTWLADTDDKVDVDLVDFDHLITKDKLEEGEDFADYLTPQTEFHVSAVAD
Kwal_47.19272      EGDFKKTKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIAD
SAKL0F00748g       EGDFKKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIAD
KNAG0I00220        EGDFKKTKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIAD
TDEL0D06370        DGDFKKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIAD
TPHA0A06020        EGDFKKTKHKITWLAETEDVTKVDLVDFDHLITKDKLEEDESFENFLTPNTEFHTDAIAD
Kpol_507.8         EGDFKKTKHKVTWLADTEDVVKVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIAD
CAGL0C01947g       EGDFKKTKHKLTWLADTDDSVKVDLVDFDHLISKDKLEEDESFEDFLTPQTEFHTEAIAD
KAFR0J02890        EGDFKKTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIAD
Suva_7.16          EGDFKKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIAD
Skud_7.22          EGDFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIAD
Smik_7.16          EGDFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIAD
YGL245W            EGDFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIAD
NDAI0I03250        DGDFKKTKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIAD
NCAS0E00250        EGDFKKTKHKLTWLADTPDVVPVDLVDFDHLITKDKLEEDESFEDFLTPVTEFHTDAIAD
                    ****.*  *:****:* * . .::******:.**.:** :.* :::*  *** . * .*

ZYRO0E09570g       VNVKDMKVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK
AFR264W            LNVKDMKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK
TBLA0E00190        LNVKDMKIGDFIQFERKGYYRLDSLPKNGNPYVFFTIPDGKAVNKYGAKK
KLLA0A00682g       LNVKDMKVGDIIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK
KLTH0G00682g       LNVKDMKKGDIIQFERKGYYRLDSFATADKPYVFFAIPDGKSVNKYGAKK
Kwal_47.19272      LNVKDMKKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK
SAKL0F00748g       LNVKDMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK
KNAG0I00220        LNVKHMKVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK
TDEL0D06370        LNVKDLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK
TPHA0A06020        VNVKDMKVGDIIQFERKGYYRLDALPKDGKPYIFFTIPDGKAVNKYGAKK
Kpol_507.8         LNVKDMKVGDIIQFERKGYYRLDSLAADGKPYVFFTIPDGKSVNKYGAKK
CAGL0C01947g       LNVKDMIVGDIIQFERKGYYRLDAEAKDGKPYVFFTIPDGKSVNKYGAKK
KAFR0J02890        LNVKEMKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK
Suva_7.16          LNVKDMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK
Skud_7.22          LNVKDMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK
Smik_7.16          LNVKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK
YGL245W            LNVKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK
NDAI0I03250        LNVKDMKVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK
NCAS0E00250        LNVKDMKVGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK
                   :*** :  **.:****.** ***:    .:*::**:*****:**.*****

FASTA FORMAT for MUSCLE Version 3.6

>ZYRO0E09570g
-MV-NLVINGKAPVVAYAELIASRIVNAAHKD-AITVEFVDEKNAAPVVFNGSSDDTFAK
IISTYPDVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKIS
AADIVCWGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVT
AGKKKEGHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLII
RFDDTNPSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDT
DVEKMREERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRD
PVIYRCNLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKAL
RLRKVHIWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTVRGVRRRGMTVEGLRN
FVISQGPSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKP
KHKKNPAVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNL
GGDFKKTKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGD
VNVKDMKVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK
>AFR264W
MSS-TLIIAAKSPAVAYAELIAARAVNEAKQD-AVAIQFTEGKEAAAASFDGESQNALER
MVEKYPDVLGSVP-EEAAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPT
VADVAVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGN
VNKKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLII
RFDDTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDT
PTERMREERMEGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKD
PVLYRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNAL
KLRKVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRN
FVLSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKP
KHKKNPAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNL
EGDFKKTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIAD
LNVKDMKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK
>TBLA0E00190
MST-KLILSGKAQAVAYGELIAARIVNNSSAN-AVDISFVEDKKAAPATLDGSSDDVLAK
IVALSPSSFASASKEDVAHWTKLAQEKLVVKNFQQLAQTLEILDAQLNLRSFVLGGLNFS
AADVAVWGALRSNGMVGSIIKNKVYVNVSRWYSFLELEPAFGESHEFLTKSLQELKKAAN
AGKKKESHKANFEIDLQDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLII
RFDDTNPSKEKEEFEESIIEDLALLGIKGDRVTHSSDYFQEMYDYCIQMIKEGKAYCDDT
PTEKMREERMEGEPSARRNRSVEENLKIFTEDMTNGTEEGLKNCVRAKIDYKALNKTLRD
PVIYRCNLTPHHITGDKWKVYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYEWMLDAL
KLRHVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMSIEGLRN
FVLSQGPSRNVINLEWNLIWAFNKKVIDPTAPRHTAVVNPFKVHLEGSEVPQTDKIEMKP
KHKKNPDVGEKKVVFSKNIIIDKEDADVLEEGEEFTLMDWGNAIITKKDAN-SITAKLHL
EGDFKKTKHKITWLADTKDVVSVDLVDFDHLLNKDRIEEGESFEDFLTEKTEFHTSAIAD
LNVKDMKIGDFIQFERKGYYRLDSLPKNGNPYVFFTIPDGKAVNKYGAKK
>KLLA0A00682g
MSA-SLIIGAKAPVIAYPELIAARKVNASKGDNTIEISFVEDKKAAAASFNGETEDVLTK
LSAAYPDILNDNS-DSSAEWIEFGAKQLVIKNFQQLAESLAKLNAHLNLRTYILNTLEPS
LADIAVWGYLRSNGMVGSIIKNKVYINVSRWYSTFELIPEFGQAHEFLTKSLQELKKASN
VNKKKETHKANFEIGLPDAKVGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLII
RFDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKEGKAYCDDT
PTERMREERTEGIPSSRRERTVEENLKIFTEEMKNGTEEGLKNCVRAKIDYEALNKAMRD
PVIYRCNLTPHHRTGTAWKIYPTYDFCVPIVDSLEGVTHALRTIEYRDRNPQYDWMLNAL
HLRKVHIWDFARVNFVRTLLSKRKLQWLVDKDIVSNWDDPRFPTVRGVRRRGMTIEGLRN
FVLSQGPSRNVINLEWNLIWSFNKKVIDPVAPRHTAIVSPVKVHLEGDDVPQTPNVEMKL
KHKKNPAIGEKKVIYYKDIVIDEEDAKLLSEGEEVTLMDWGNAIITKKNDDGSFNAKLHL
EGDFKTTKFKLTWLADTDDKVEADLVDFDHLISKDKLEEGENFEDFLTPKTEFHTTAYAD
LNVKDMKVGDIIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK
>KLTH0G00682g
-MA-KLIIASKAPVVAYSELIAARLVNSAKTD-AIEIEFVEDKKSSPATFEDSCDDVLKR
IVQTYPEVFKHGF-ENCDEWAKLASEELTVKNFQKLSVSLAKLDACLNFRTFILGGTTFS
AADIACWGSLRSNGMVGSIIKNKVYVNVSRWYTLLEQIPEFGSAHEFLVKTLQELKKAST
SNKKKETHKANFEIDLQDAKVGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLII
RFDDTNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVKMIEEGNAYCDDT
PTDKMREERMDGLASARRDRSVEENLRIFTQEMKNGTEEGLKNCVRAKIDYKALNKTLRD
PVIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYQWMLDAL
HLRKVHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTVRGVRRRGMTVEGLRN
FVLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVKPVKFHVEG--APQTPDVQIKL
KHKKNPAVGEKKVIYYADILIDQDDADAVTEGEELTLMDWGNAIVTKKNADGSLTGKLHL
EGDFKKTKLKLTWLADTDDKVDVDLVDFDHLITKDKLEEGEDFADYLTPQTEFHVSAVAD
LNVKDMKKGDIIQFERKGYYRLDSFATADKPYVFFAIPDGKSVNKYGAKK
>Kwal_47.19272
-MA-KLTLASKAPVVAYSELIAARLTNAVKPG-TIEIDFVEDKKASPATFEGNSNDVLKT
IVESFPEAFKGGF-DGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYS
PADIACWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKAST
GNKKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLII
RFDDTNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDT
ATERMREERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRD
PVIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNAL
HLRKVHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTVRGVRRRGMTVEGLRN
FVLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDG--APQTPDVQMKL
KHKKNPAVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHL
EGDFKKTKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIAD
LNVKDMKKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK
>SAKL0F00748g
MSA-NLVINGKAPVVAYAELIAARIVNASKAD-AIKIEFVDDKKAAPATFNGEADSAFSK
IINAYQDVFSEGV-QGSSEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTAT
PADIACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASN
SNKKKETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLII
RFDDTNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDT
PTEKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRD
PVIFRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDAL
HLRKVHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTVRGVRRRGMTVEGLRN
FVLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKL
KHKKNPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHL
EGDFKKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIAD
LNVKDMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK
>KNAG0I00220
MSAATLVINGKAPIVAYGPLIAARIANSAKSS-SVAIEFVDDKNAAPAVFNGDSEDVLSK
IAAQFPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYS
VADIACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKAST
AGKKKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLII
RFDDTNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDT
PTEKMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRD
PVIYRCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNAL
HLRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTVRGVRRRGMTVEGLRN
FVLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEG--APETPKTEMKP
KHKKNPAVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHL
EGDFKKTKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIAD
LNVKHMKVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK
>TDEL0D06370
-MA-KLIINGKAPVVAYAELIAARVVNTVNPE-SINVEFVDDKKAAPAVLDGESEGVFMK
IIEAFPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYS
AADIACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASN
VGKKKEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLII
RFDDTNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDT
VTEKMREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRD
PVIYRCNLTPHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAM
NLRKVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTVRGVRRRGMTVEGLRN
FVLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKP
KHKKNPDVGEKKVIFYKDVVIDKDDADVLEDNEEVTLMDWGNVIITKKNADGSLEGKLNL
DGDFKKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIAD
LNVKDLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK
>TPHA0A06020
MPA-TLIIGGKSSVVAYSELIAARIVNSVKPD-SITIEFVEDKKAAAASLNGETDDVLSK
IVSANADVFPEGV-TGSEEWVKLAVSELVIKNFQKLATSLDKLDAHLNLRTFINGGLSYS
IADIACWGALRSNGMVGSIIKNKVNVNVSRWYTLFESNPIFGEANEFLTKSLQELKKASS
AGKKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFADAYKGKLII
RFDDTNPSKEKVEFQESILEDLALLGIKGDRITHSSDYFQEMYDYCIQLIKEGKAYCDDT
PVDKMREERMDGIASARRNRSVEENLKIFTEEMQNGTEEGLQNCVRAKIDYEALNKTLRD
PVIYRCNLNPHHRTGTAWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYEWMLNAM
NLRKVHIWDFARVNFVRTLLSKRKLQWMVDKELVSNWDDPRFPTVRGVRRRGMTIEGLRN
FVISQGPSRNVINLEWNLIWAFNKKVIDPVAPRLTCVINPIKIHLSGADAPETPRVEMKP
KHPKNPAVGEKRVIFSKDIVIDKDDADVIEEGEEITLMNWGNAIIDKKNADGSIDATLHL
EGDFKKTKHKITWLAETEDVTKVDLVDFDHLITKDKLEEDESFENFLTPNTEFHTDAIAD
VNVKDMKVGDIIQFERKGYYRLDALPKDGKPYIFFTIPDGKAVNKYGAKK
>Kpol_507.8
MSA-TLVIGGKAPVVAYAELIAARIVNSSKPD-SIKIEFVEDKKASPATLNGDSVDVLSK
IVTANSDVFPEGA-ANSTEWIKIASEELVVKNFQQLNKSLEKLDAHLNLRTYINGGLNFT
VADIACWGALRSNGMVGSIIKNKVNVNVSRWYTLLEENTLFGGVHEFLTKSLQELKKAST
AGKKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLII
RFDDTNPSKENVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQLIKDGKAYCDDT
PTEKMRDERMNGIASVRRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRD
PVIFRCNLTPHHRTGSQWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNAL
KLRKVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWEDPRFPTVRGVRRRGMTVEGLRN
FVLSQGPSRNVINLEWNLIWSFNKKVIDPVCPRLTAVVDPVKIHLEGEDAPQSAKVEMKP
KHPKNPVVGEKKVVFYKDIVIDREDADSIEDGEEITLMNWGNAIITKKNADGSLNAKLHL
EGDFKKTKHKVTWLADTEDVVKVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIAD
LNVKDMKVGDIIQFERKGYYRLDSLAADGKPYVFFTIPDGKSVNKYGAKK
>CAGL0C01947g
MSS-TLVINGKAPVVAYAELIAARLVNDSKSDASVTVEFVDDKKSAAATFDGKSDNALEA
IVAKFPEILGAN--EESKPWIKLAAEELVIKNFQKLAQSLEKLDAQLNFRTYINGGLKFD
SADIACWGALRSNGMVGSIIKNKVYVNVSRWYLLLESNPSFGQSHEFLTKSLQELKKAAN
AGKKKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLII
RFDDTNPSKEKTEFQDSILEDLELLGIKGDRITYSSDYFQEMYELCVKLIKEGKAYCDDT
PTEKMREERMDGIASARRERSVEENLKIFTEDMKNGTEEGLKNCVRAKIDYAALNKTLRD
PVIYRCNLTPHHRTGSEWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWFLDNL
NLRKVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTVRGVRRRGMTVEGLRN
FVLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVNPVKIHIEG--APESPKTEMKP
KHKKNPAVGEKKVIYYQNVVIDKEDADSIEDNEEVTLMDWGNIIITKKNADGSMEAKLHL
EGDFKKTKHKLTWLADTDDSVKVDLVDFDHLISKDKLEEDESFEDFLTPQTEFHTEAIAD
LNVKDMIVGDIIQFERKGYYRLDAEAKDGKPYVFFTIPDGKSVNKYGAKK
>KAFR0J02890
MSA-TLVINGKAPVVAYDSLIAARLVNAARPD-AIKIEFVDDKKSAPATFNGSSEGSFNK
IVAAFPDAFRNA--NVASEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYS
AADIAAWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNAS
AGKKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLII
RFDDTNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDT
PTEKMREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRD
PVIYRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNAL
HLRKVHIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTVRGVRRRGMTVEGLRN
FVLSQGPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKP
KHKKNPAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHL
EGDFKKTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIAD
LNVKEMKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK
>Suva_7.16
MPS-TLTINGKAPAVAYAELIAARIVNALAPN-SIAVEFVDDKKAPAAKLDDATEDVFNK
ITGKFAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYS
AADVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNAN
VGKKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMII
RFDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDT
PTEKMREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRD
PVIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQAL
RLRKVHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTVRGVRRRGMTVEGLRN
FVLSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKP
KHKKNPAVGEKKVIYYKDIVVDKDDADVIDVDEEVTLMDWGNVVITKKNADGSMVAKLHL
EGDFKKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIAD
LNVKDMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK
>Skud_7.22
MPS-TLTVNGKAPSVAYAELIAARIVNALAPN-SIAIQFVDDKKAPAAKLDDATEGVFNK
ITGKFAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYS
AADVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSAN
VGKKKETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLII
RFDDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDT
PTERMREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRD
PVIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQAL
RLRKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRN
FVLSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKP
KHKKNPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHL
EGDFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIAD
LNVKDMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK
>Smik_7.16
MPS-TLTINGKAPIVAYAELIAARIVNALAPN-SIAIVFVDDKKAPAAILDDATEDVFSK
ITGKFAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYS
AADVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSAN
VGKKKETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLII
RFDDTNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDT
PTEKMREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRD
PVIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQAL
RLRKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRN
FVLSQGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQEPKTETKP
KHKKNPAVGEKKVIYYKDIVVDKDDADVINVDEEITLMDWGNVIITKKNEDGSMIAKLNL
EGDFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIAD
LNVKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK
>YGL245W
MPS-TLTINGKAPIVAYAELIAARIVNALAPN-SIAIKLVDDKKAPAAKLDDATEDVFNK
ITSKFAAIFDNGDKEQVAKWVNLAQKELVIKNFAKLSQSLETLDSQLNLRTFILGGLKYS
AADVACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLLELKKSAN
VGKKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLII
RFDDTNPSKEKEEFQDSILEDLDLLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDT
PTEKMREERMDGVASARRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRD
PVIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNAQYDWMLQAL
RLRKVHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRN
FVLSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGSEAPQEPKIEMKP
KHKKNPAVGEKKVIYYKDIVVDKDDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLNL
EGDFKKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIAD
LNVKDMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK
>NDAI0I03250
MSANTLVINGKAPVVAYGDLIAARIINDAKPT-SIDIQFVDDKKSAPSVFNGSSDSTFLK
IIEGFPEIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYS
AADIACWGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSN
SGKKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLII
RFDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDT
PTEKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRD
PVIYRCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAM
NLRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMTVEGLRN
FVLSQGPSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKP
KHKKNPAVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHL
DGDFKKTKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIAD
LNVKDMKVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK
>NCAS0E00250
MSA-TLVINGKAPVVAYAELIAARIVNETKPN-SISIEFVDDKKAAPATFNGDNKDAFLK
IVAQFSDVFSNSKEEDITQWVKMASEELVIKNFQKLSESLGKLDAHLNLRTFILGGLKYS
AADIACWGALRSNGMCGSIIKNKVEVNVSRWYTLLEMDPIFGSVHEFLTKSLQELKKTAN
AGKKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLII
RFDDTNPSKEKEEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCIQMIKEGKAYCDDT
PTEKMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRD
PVIYRCNLTPHHRTGTTWKVYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLQAL
NLRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMTVEGLRN
FVLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVNPVKIHLEGDDVPQTPKIEMKP
KHKKNPAVGEKKVIYFKDIVIDKDDADLLEANEEVTMMDWGNVIITQKNADGSLVGKLHL
EGDFKKTKHKLTWLADTPDVVPVDLVDFDHLITKDKLEEDESFEDFLTPVTEFHTDAIAD
LNVKDMKVGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK