MUSCLE (3.8) multiple sequence alignment

TPHA0D04205              ---------------MFSKMKALFHKPREINNQQGKPTSYVIDEDPLPKRSKKEILKRAV
KAFR0G03675              ------------MNMAMAKLVNIITT----IK-------WKASN----------------
Kpol_YGOB_YPR145C-A      ------------MSVIIRDLKNILFK----HH-GN-----GFEL----------------
NCAS0F03520              -----MEYFKNTMSNIFNKLKHIFET-------ESTTHTDNRHV----------------
Cgla_YGOB_Anc_3.484      ------------MDQTLQKIKDIFFG----WK-KEKAVD-RTSE----------------
Suva_16.475              ------------MSATFKKIKLMFKR----ND-RQYSPNYGTEM----------------
YPR145C-A                ------------MSTAFRKIKLIFKK----SD-SQYPQNYRAEI----------------
Skud_16.440              ------------MSITFRKIKLIFKR----ND-SEYPQSYRAEM----------------
Smik_16.397              ------------MSITFRKIKLIFKK----ND-SRYPQNYRAEM----------------
NDAI0B05820              -----------MNYFQMSFLKDISKS----VK-----NIFTSDD----------------
Agos_YGOB_YPR145C-A      ----MLLFMSKQRSPRLSALKAIRKT----LS-CTVGTLSMMNP----------------
KNAG0A07925              MAEQSRIMTSLTANPSFLRMKIPF---------CKIGSTSTESN----------------
                                         :  :                                        

TPHA0D04205              SLKSIHHDKSKKSKNNKPITRYDIFNSHYGEQFHSKVSVIINREETANFFYYTDASSK--
KAFR0G03675              ---------KKPRR----VTRYDILKQDSAYSTTA-----SSKSSSGHTITRDISSI---
Kpol_YGOB_YPR145C-A      ---------IKKLKSGIGFTKHIVHHSHSRCKVVT-------RYDILKNFYY--------
NCAS0F03520              ---------QKQTKPDV-VTRYDLLHGRNGAKSNL-----RSKSKSKGGKHHPISARVV-
Cgla_YGOB_Anc_3.484      ---------RWQKRHAV-VTRHDLLNGHNDAIKRS------RRSSSRSRSHPGSKSRSNS
Suva_16.475              ---------KPKNKNTV-ITRHDLLIAYEKEQRAS-----LDRSNSIRNLHLQDKRLEKR
YPR145C-A                ---------KSRNKNTV-ITRHDLLIAHEMKQRAS-----LERSNSIRNLQSQGKRRSDS
Skud_16.440              ---------KSKNKNTV-ITRHDLLIAHEREQRAS-----LDRISSISNLQSQDKRGEKR
Smik_16.397              -----------KSKNTV-ITRHDLLIAHEREQRAS-----LDRTNSISNLQSHEKRREER
NDAI0B05820              ---------KKGSKPTV-ITRYDLLNSSNVQNRRS-----FSMERHKNQRHRRDTISTEK
Agos_YGOB_YPR145C-A      ---------FKKRDTTV-ITRQDLLRKRSNSPSDS-----GALPARQSNSHVIGSRGAHR
KNAG0A07925              ---------KHKNHPSK-ITRYDLLARD------------LEYSRRHHPLK---------
                                           .*.  :                                    

TPHA0D04205              ---------------------
KAFR0G03675              ---------------------
Kpol_YGOB_YPR145C-A      ---------------------
NCAS0F03520              ---------------------
Cgla_YGOB_Anc_3.484      Q--------------------
Suva_16.475              TKRNI----------------
YPR145C-A                KESRKL---------------
Skud_16.440              SKRA-----------------
Smik_16.397              SKRAYKLVNDSIN--------
NDAI0B05820              TMLSSRHTA------------
Agos_YGOB_YPR145C-A      ESHASCRTPAVKDTLLLTSLL
KNAG0A07925              ---------------------
                                              

FASTA FORMAT for MUSCLE Version 3.6

>TPHA0D04205
---------------MFSKMKALFHKPREINNQQGKPTSYVIDEDPLPKRSKKEILKRAV
SLKSIHHDKSKKSKNNKPITRYDIFNSHYGEQFHSKVSVIINREETANFFYYTDASSK--
---------------------
>KAFR0G03675
------------MNMAMAKLVNIITT----IK-------WKASN----------------
---------KKPRR----VTRYDILKQDSAYSTTA-----SSKSSSGHTITRDISSI---
---------------------
>Kpol_YGOB_YPR145C-A
------------MSVIIRDLKNILFK----HH-GN-----GFEL----------------
---------IKKLKSGIGFTKHIVHHSHSRCKVVT-------RYDILKNFYY--------
---------------------
>NCAS0F03520
-----MEYFKNTMSNIFNKLKHIFET-------ESTTHTDNRHV----------------
---------QKQTKPDV-VTRYDLLHGRNGAKSNL-----RSKSKSKGGKHHPISARVV-
---------------------
>Cgla_YGOB_Anc_3.484
------------MDQTLQKIKDIFFG----WK-KEKAVD-RTSE----------------
---------RWQKRHAV-VTRHDLLNGHNDAIKRS------RRSSSRSRSHPGSKSRSNS
Q--------------------
>Suva_16.475
------------MSATFKKIKLMFKR----ND-RQYSPNYGTEM----------------
---------KPKNKNTV-ITRHDLLIAYEKEQRAS-----LDRSNSIRNLHLQDKRLEKR
TKRNI----------------
>YPR145C-A
------------MSTAFRKIKLIFKK----SD-SQYPQNYRAEI----------------
---------KSRNKNTV-ITRHDLLIAHEMKQRAS-----LERSNSIRNLQSQGKRRSDS
KESRKL---------------
>Skud_16.440
------------MSITFRKIKLIFKR----ND-SEYPQSYRAEM----------------
---------KSKNKNTV-ITRHDLLIAHEREQRAS-----LDRISSISNLQSQDKRGEKR
SKRA-----------------
>Smik_16.397
------------MSITFRKIKLIFKK----ND-SRYPQNYRAEM----------------
-----------KSKNTV-ITRHDLLIAHEREQRAS-----LDRTNSISNLQSHEKRREER
SKRAYKLVNDSIN--------
>NDAI0B05820
-----------MNYFQMSFLKDISKS----VK-----NIFTSDD----------------
---------KKGSKPTV-ITRYDLLNSSNVQNRRS-----FSMERHKNQRHRRDTISTEK
TMLSSRHTA------------
>Agos_YGOB_YPR145C-A
----MLLFMSKQRSPRLSALKAIRKT----LS-CTVGTLSMMNP----------------
---------FKKRDTTV-ITRQDLLRKRSNSPSDS-----GALPARQSNSHVIGSRGAHR
ESHASCRTPAVKDTLLLTSLL
>KNAG0A07925
MAEQSRIMTSLTANPSFLRMKIPF---------CKIGSTSTESN----------------
---------KHKNHPSK-ITRYDLLARD------------LEYSRRHHPLK---------
---------------------