MUSCLE (3.8) multiple sequence alignment

SAKL0F02574g       MRFTPGTTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREAC
KLTH0G02420g       MSITASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECA
Kwal_47.18893      MNLTPSTTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVG
                   * :*..**::*.****:* *.:* *::***::   *. *:* ***:** **** ****  

SAKL0F02574g       LGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL
KLTH0G02420g       TAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPC
Kwal_47.18893      LGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPI
                    .::***:*:*:***.::*:***:  :::***.***** :**: .**::*:**:*** * 

SAKL0F02574g       TNKEKRLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLT
KLTH0G02420g       AETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNPWLT
Kwal_47.18893      AATEERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLT
                   : .*:****:**:** *  **:.*****.*.*:****:*.*:**::.*****:*******

SAKL0F02574g       RKELSNYCHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVP
KLTH0G02420g       RKDLVKYCKERDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVP
Kwal_47.18893      RKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIP
                   **:* :** :..:*::*:**:**...:.** : :*:: *** .*.**:*:.*******:*

SAKL0F02574g       LVKTVHEDRLKENIKSCDFELSSADLKKLTHDDQYYLSQPKWDPIKYEG
KLTH0G02420g       LPKSVHEDRAESNLHALDFEISAEDMKTLTHDGEHFLAQPGFDPIETED
Kwal_47.18893      LPKSSNSKRQISNLQALDFEISDKDMKALTHDDTYFLATEDFDPIKTQP
                   * *: :..*  .*::: ***:*  *:* ****. ::*:   :***: : 

FASTA FORMAT for MUSCLE Version 3.6

>SAKL0F02574g
MRFTPGTTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREAC
LGITKFLEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL
TNKEKRLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGLKIDPMVNQYELNPWLT
RKELSNYCHQKGMVIQAYSPLTRARRLQDPELVKLVEDSYPEQTSAQILVNWSLQMGFVP
LVKTVHEDRLKENIKSCDFELSSADLKKLTHDDQYYLSQPKWDPIKYEG
>KLTH0G02420g
MSITASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECA
TAVAKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPC
AETEKRLGTYKALQEFYKAGKIKAIGVSSYSIKHLEELYSWEGLEVKPMVNQFELNPWLT
RKDLVKYCKERDLVIEAFSPITRSKRFSDPVVQKLLKESYPGRTPAQLLIRWSLQMGFVP
LPKSVHEDRAESNLHALDFEISAEDMKTLTHDGEHFLAQPGFDPIETED
>Kwal_47.18893
MNLTPSTTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVG
LGIAKFLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPI
AATEERLGTWKALQEAYAEGKVRAIGVSNYSIKHLEELYNWEGLKVEPMVNQFELNPWLT
RKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQELIKTSYPNQTPAQILIRWSLQMGFIP
LPKSSNSKRQISNLQALDFEISDKDMKALTHDDTYFLATEDFDPIKTQP