MUSCLE (3.8) multiple sequence alignment

KAFR0B02760              MIFSKVLHQKNLKL------QAIKSQIPKLNPKSGRAGGPWGLMEFKRQIVLIPGFLLTL
NCAS0B03770              MIFNTILRNTARRAG-----ASSRQAFTRSYTVGPLTGVRWLKGEVKRVTPTLGVWASIL
KAFR0B05440              MPNKQLFRTLNF----------ARFYAATSKTHAQHIGPPYLYLKAKQDVKTIAAWGTFL
NDAI0J01290              MLFNSVLKRSIRNTA-----VRQFVTNGAAHTIRPVRGLPWVSSEIQRVAPTILRWSTFL
Ecym_4297                MLYSRILKAVSTIPK-----SPMSNIGARRAATSKHIGEPWMVTETKRLVPTILIWGGTM
CAGL0B01875g             MFRSVGINRMRYVMNSS---MTRSLSSTARTQAQGRIGPSWTIAEIKRLTPTLIGWASFL
TBLA0F03030              MLFQHAARSSAS----------MARMQLRRSFTRSYTQESWAVTEVKRIVPNIAFWATLL
KNAG0H03170              MFRSQVSKSLQR---------MSKPIGLRYASSGGRVGPGFYRTEIKRRIPQVALWGSGL
Kpol_YGOB_YDR119W-A      MFSRILARTTARVGRVQ---AVRYASTANQAAAAGHIGESWAVTEAKRVFPTIIGWGTTL
TPHA0A01740              MFSKIISQSTARIANRQ---IIRHSSNAAKTPGSSHLGESWILTEAKRVGPNLLFWGSAM
ZYRO0D06908g             MFFTQVLRNSAV----------SATKQAAKQISKSSAGEQWGLLEARRLSRGAVEWAVSL
KLLA0F19371g             MFFTKALRSTATIAMN----HATQTTTKTAVRSGRRVGEAWAVTEARRLGPTILMYGTFI
Suva_2.280               MFFSQVLRSSAR-------------AAPIKRYTGGRVGEAWMITESRRLIPEVFQWGAVI
YDR119W-A                MFFSQVLRSSAR-------------AAPIKRYTGGRIGESWVITEGRRLIPEIFQWSAVL
Skud_4.380               MFFSQVLRSSAR-------------AAPIKRYTGGRVGESWVITEGRRLIPEVLQWSAAL
Smik_4.364               MFFSEVLRSSAR-------------AAPIKRYTGGRVGESWVITEGRRLIPEVFQWSATL
TDEL0F04000              MFYTQVLRSAAA---------------AARATSRNHNSQSWAVSEAKRLTPAILGWGGFL
SAKL0H16786g             MFSSQVLRSTAAISRSAV--ASKGASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASM
KLTH0G13442g             MLSSQILKSVATLQGVAASQVSRSASRVVLKGPSSRARK-WAVIEAKRLVPAIGMWGAFM
Kwal_YGOB_YDR119W-A      MLSSQILRSVAALQGVAATSASKAGSRVMFKAPSSRARQ-WAVIEAKRIVPTVAMWATSM
                         *      .                                :   : ..       :   :

KAFR0B02760              SVLCFWPFSIRAV-----HRVRHKDTSSMI--
NCAS0B03770              ITTLL---------------------------
KAFR0B05440              LVALGWPSVIYYS-----RRR-----------
NDAI0J01290              VVVLGWPAPFYYY-----HKIKYQS-------
Ecym_4297                TGILLWPIIFRVY-----IEEILK--------
CAGL0B01875g             TVTLGWPFGIYFW-----KKPN----------
TBLA0F03030              SVSLGWPFCFVWYQDRVTKKYANLD-------
KNAG0H03170              FLVLEWPFFFKWY-----NQWAHGV-------
Kpol_YGOB_YDR119W-A      TAILSWPFIIYHY-----KAPDY---------
TPHA0A01740              TTVLLWPSFIKYF-----KDPNYKERY-----
ZYRO0D06908g             SLILAWPAAIIKF-----SEHNRWLKAREEYS
KLLA0F19371g             VSVLGWPFLVRKADMDIGIHGMKQ--------
Suva_2.280               CTCLGWPGAVYFF-----SKARKA--------
YDR119W-A                SVCLGWPGAVYFF-----SKARKA--------
Skud_4.380               SICLGWPGAVYFL-----SKARKA--------
Smik_4.364               SICLGWPSAVYFF-----SKARK---------
TDEL0F04000              AGCLGWPFAIKHF-----MSAN----------
SAKL0H16786g             AAVLGWPFAVKKI-----VHS-----------
KLTH0G13442g             GAVLGWPFAVRAL-----VH------------
Kwal_YGOB_YDR119W-A      TIMLGWPFGVRAI-----VH------------
                                                         

FASTA FORMAT for MUSCLE Version 3.6

>KAFR0B02760
MIFSKVLHQKNLKL------QAIKSQIPKLNPKSGRAGGPWGLMEFKRQIVLIPGFLLTL
SVLCFWPFSIRAV-----HRVRHKDTSSMI--
>NCAS0B03770
MIFNTILRNTARRAG-----ASSRQAFTRSYTVGPLTGVRWLKGEVKRVTPTLGVWASIL
ITTLL---------------------------
>KAFR0B05440
MPNKQLFRTLNF----------ARFYAATSKTHAQHIGPPYLYLKAKQDVKTIAAWGTFL
LVALGWPSVIYYS-----RRR-----------
>NDAI0J01290
MLFNSVLKRSIRNTA-----VRQFVTNGAAHTIRPVRGLPWVSSEIQRVAPTILRWSTFL
VVVLGWPAPFYYY-----HKIKYQS-------
>Ecym_4297
MLYSRILKAVSTIPK-----SPMSNIGARRAATSKHIGEPWMVTETKRLVPTILIWGGTM
TGILLWPIIFRVY-----IEEILK--------
>CAGL0B01875g
MFRSVGINRMRYVMNSS---MTRSLSSTARTQAQGRIGPSWTIAEIKRLTPTLIGWASFL
TVTLGWPFGIYFW-----KKPN----------
>TBLA0F03030
MLFQHAARSSAS----------MARMQLRRSFTRSYTQESWAVTEVKRIVPNIAFWATLL
SVSLGWPFCFVWYQDRVTKKYANLD-------
>KNAG0H03170
MFRSQVSKSLQR---------MSKPIGLRYASSGGRVGPGFYRTEIKRRIPQVALWGSGL
FLVLEWPFFFKWY-----NQWAHGV-------
>Kpol_YGOB_YDR119W-A
MFSRILARTTARVGRVQ---AVRYASTANQAAAAGHIGESWAVTEAKRVFPTIIGWGTTL
TAILSWPFIIYHY-----KAPDY---------
>TPHA0A01740
MFSKIISQSTARIANRQ---IIRHSSNAAKTPGSSHLGESWILTEAKRVGPNLLFWGSAM
TTVLLWPSFIKYF-----KDPNYKERY-----
>ZYRO0D06908g
MFFTQVLRNSAV----------SATKQAAKQISKSSAGEQWGLLEARRLSRGAVEWAVSL
SLILAWPAAIIKF-----SEHNRWLKAREEYS
>KLLA0F19371g
MFFTKALRSTATIAMN----HATQTTTKTAVRSGRRVGEAWAVTEARRLGPTILMYGTFI
VSVLGWPFLVRKADMDIGIHGMKQ--------
>Suva_2.280
MFFSQVLRSSAR-------------AAPIKRYTGGRVGEAWMITESRRLIPEVFQWGAVI
CTCLGWPGAVYFF-----SKARKA--------
>YDR119W-A
MFFSQVLRSSAR-------------AAPIKRYTGGRIGESWVITEGRRLIPEIFQWSAVL
SVCLGWPGAVYFF-----SKARKA--------
>Skud_4.380
MFFSQVLRSSAR-------------AAPIKRYTGGRVGESWVITEGRRLIPEVLQWSAAL
SICLGWPGAVYFL-----SKARKA--------
>Smik_4.364
MFFSEVLRSSAR-------------AAPIKRYTGGRVGESWVITEGRRLIPEVFQWSATL
SICLGWPSAVYFF-----SKARK---------
>TDEL0F04000
MFYTQVLRSAAA---------------AARATSRNHNSQSWAVSEAKRLTPAILGWGGFL
AGCLGWPFAIKHF-----MSAN----------
>SAKL0H16786g
MFSSQVLRSTAAISRSAV--ASKGASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASM
AAVLGWPFAVKKI-----VHS-----------
>KLTH0G13442g
MLSSQILKSVATLQGVAASQVSRSASRVVLKGPSSRARK-WAVIEAKRLVPAIGMWGAFM
GAVLGWPFAVRAL-----VH------------
>Kwal_YGOB_YDR119W-A
MLSSQILRSVAALQGVAATSASKAGSRVMFKAPSSRARQ-WAVIEAKRIVPTVAMWATSM
TIMLGWPFGVRAI-----VH------------