MUSCLE (3.8) multiple sequence alignment

ZYRO0G06710g      MSKLVPIASHSLSPDTSGPYEEGEKGNAYQKTSDNEKGEYVDVSGREIISDEHRKQPRQL
TDEL0B02240       MTSLIPIASPGLSANTERAYTEIKKDHIYQDSVEQEKGEFVDEFGREILANESEKFGHKL
                  *:.*:**** .**.:*. .* * :*.: **.: ::****:**  ****:::*  *  .:*

ZYRO0G06710g      PLQAYSHYADIQREYERSKDYDGLYAVQREQMYTDANSNLSPTKLDSQRMMRIAKAYSVF
TDEL0B02240       PLQAYTYYADIQREYERSNDQDGLYAAQREQIYTDSFSNLSHSKLDSQRLLRITKAYSVF
                  *****::***********:* *****.****:***: **** :******::**:******

ZYRO0G06710g      FLITTDILGPSNAPNAISQMGYVPGVILYVVFGIAAACGGWLLNHCFCKVDSNNYPIRTF
TDEL0B02240       FLITTDILGPSNAPYAVAQMGWVPGVILYVLFGVVAAFGGWLLNYCFCKVDSNNYPIRTY
                  ************** *::***:********:**:.** ******:**************:

ZYRO0G06710g      SDLASRVVAPWFRYPFGLLQFIQMILNCGLLLLSTAQAVSQMLIVNRGKDNFCFTVDILV
TDEL0B02240       SDLAGRVVAPWFRYPFAILQFIQMILNCGAILLSTAQAVSQMLIVNKGRDPFCFTVDILV
                  ****.***********.:*********** :***************.*.* *********

ZYRO0G06710g      WALLCMIAGQISSLGKFAHIANSAVWMNIAICICTMVGVAVGGPYYGIFQQYGKGPPYYY
TDEL0B02240       WALLCMILGQIRSLGRFAHIANTAVWMNIAVCIITMVGVAVGGPYYGIFQQYGQGPPYFQ
                  ******* *** ***.******:*******:** *******************:****: 

ZYRO0G06710g      PDTFNPLPIVKHAIAPGSLGDRIAGMNNMVFAWGGATIFCEVMAEMKRPMDFWKGMLCAQ
TDEL0B02240       SGTFNPLPITQHAITPGTISDKIAGMNNMVFAWGGATIFCEVMAEMKRPMDFWKGMLCAQ
                  ..*******.:***:**::.*.**************************************

ZYRO0G06710g      SLILVVYLFYGLFVYTYNGQFCYVTANQAIASVGLQNAGNVLTIVSGLIAMVLYGNVAIK
TDEL0B02240       SLIMVVYLFYGLFVYAYNGQFSYVNANQAIGSKGLQNAGNVLTIITGIIATVLYGNIGIK
                  ***:***********:*****.**.*****.* ***********::*:** *****:.**

ZYRO0G06710g      VIYQGFLVADLGFPHLTTRKGTIAWGLFVIAYWAVAYILGTAIPSISALVQIVGAFCILN
TDEL0B02240       VLYQGFLITDFNFPSLSSRKGAVAWGGFVIIFWAIAYILGTAIPSVSAIVGIIGSFCILN
                  *:*****::*:.** *::***::*** *** :**:**********:**:* *:*:*****

ZYRO0G06710g      FSYTFPFLFGFCLLCRQDASLADKFDLKTLTVEKADSYLRNLSRWKRAIAHGGTRRILIK
TDEL0B02240       FSYTFPFLFCFCLLCRQDAALNDTFDQKTLSVEKADSYWRNWSRWKRSIGHGGTFRVTLK
                  ********* *********:* *.** ***:******* ** *****:*.**** *: :*

ZYRO0G06710g      CSLFLLFLASLATCGLCSYSAITGAIQAYQTNTAHAFTCTSPVG
TDEL0B02240       VSLLLLFLASLATCGLCSYSAITGAIEVYQTNTAQPFTCNSPVG
                   **:**********************:.******:.***.****

FASTA FORMAT for MUSCLE Version 3.6

>ZYRO0G06710g
MSKLVPIASHSLSPDTSGPYEEGEKGNAYQKTSDNEKGEYVDVSGREIISDEHRKQPRQL
PLQAYSHYADIQREYERSKDYDGLYAVQREQMYTDANSNLSPTKLDSQRMMRIAKAYSVF
FLITTDILGPSNAPNAISQMGYVPGVILYVVFGIAAACGGWLLNHCFCKVDSNNYPIRTF
SDLASRVVAPWFRYPFGLLQFIQMILNCGLLLLSTAQAVSQMLIVNRGKDNFCFTVDILV
WALLCMIAGQISSLGKFAHIANSAVWMNIAICICTMVGVAVGGPYYGIFQQYGKGPPYYY
PDTFNPLPIVKHAIAPGSLGDRIAGMNNMVFAWGGATIFCEVMAEMKRPMDFWKGMLCAQ
SLILVVYLFYGLFVYTYNGQFCYVTANQAIASVGLQNAGNVLTIVSGLIAMVLYGNVAIK
VIYQGFLVADLGFPHLTTRKGTIAWGLFVIAYWAVAYILGTAIPSISALVQIVGAFCILN
FSYTFPFLFGFCLLCRQDASLADKFDLKTLTVEKADSYLRNLSRWKRAIAHGGTRRILIK
CSLFLLFLASLATCGLCSYSAITGAIQAYQTNTAHAFTCTSPVG
>TDEL0B02240
MTSLIPIASPGLSANTERAYTEIKKDHIYQDSVEQEKGEFVDEFGREILANESEKFGHKL
PLQAYTYYADIQREYERSNDQDGLYAAQREQIYTDSFSNLSHSKLDSQRLLRITKAYSVF
FLITTDILGPSNAPYAVAQMGWVPGVILYVLFGVVAAFGGWLLNYCFCKVDSNNYPIRTY
SDLAGRVVAPWFRYPFAILQFIQMILNCGAILLSTAQAVSQMLIVNKGRDPFCFTVDILV
WALLCMILGQIRSLGRFAHIANTAVWMNIAVCIITMVGVAVGGPYYGIFQQYGQGPPYFQ
SGTFNPLPITQHAITPGTISDKIAGMNNMVFAWGGATIFCEVMAEMKRPMDFWKGMLCAQ
SLIMVVYLFYGLFVYAYNGQFSYVNANQAIGSKGLQNAGNVLTIITGIIATVLYGNIGIK
VLYQGFLITDFNFPSLSSRKGAVAWGGFVIIFWAIAYILGTAIPSVSAIVGIIGSFCILN
FSYTFPFLFCFCLLCRQDAALNDTFDQKTLSVEKADSYWRNWSRWKRSIGHGGTFRVTLK
VSLLLLFLASLATCGLCSYSAITGAIEVYQTNTAQPFTCNSPVG