MUSCLE (3.8) multiple sequence alignment

TBLA0A07120        ----------------------MSKYNTNEQKSTIKEEEEPLTTDQEYELWKSNVPLLYD
KAFR0L00320        --------------------------------MGPQEEERELSIDEEYKLWKSNVPLMYD
KLLA0D00814g       -------------------------------MTEVEEPEQPTTINEEYDLWVSNVPMMYD
KNAG0E00980        -----------MDLSDPKLLAAAAQLTGIDLQQLPSDENRPLDPSEEYDLWKSNVPMMYD
CAGL0B03575g       --------------MSVQLDPSALQKMAEVAAAAEQQSNEPMTVDEEYELWKSNVPMLYD
Smik_5.31          --------MSQARTFLLSIVLKLTVSTTANNRAAMETQEKALSVDEEYDLWKSNVPLMYD
YEL056W            ----------------------------------MENQEKPLSVDEEYDLWKSNVPLMYD
Suva_5.12          ----------------------------------METQEKPLSVDEEYDLWKSNVPLMYD
Skud_5.33          ----------------------------------MEGQEKPLSVDEEYDLWKSNVPLMYD
NDAI0K02900        -----MDQANAKLLEKLAADPSMLAQLTNQEETGNGDENKELTIDEEYDLWKSNVPLMYD
NCAS0F00190        --------------------MDALMEKMAAVQGEEEDPNKELSIDEEYELWRSNVPLMYD
ZYRO0F00462g       -------------------------------MSISNPPEKPLSIDEEYDLWKSNVPLMYD
TDEL0G04620        --------------------------------MAEEQVDKPLSIDEEYELWRSNVPLMYD
Kpol_1045.78       -------------------------------MEAQREQEEPLTVDQEYELWKTNVPLMYD
TPHA0M00190        -------------------------------MEKVEQQEEPLTVDQEYDLWKSNVPLLYD
SAKL0E00814g       --------------------------------MSIEEENKLLSIEEEYELWKTNVPLMYD
KLTH0C11550g       --------------------------------MQATIPENEVSVDEEYDLWKSNVPLMYD
Kwal_56.22345      --------------------------------MQSTEPERELSIDDEYDLWKSNVPLMYD
ACR017W            MTTKLKGLKELGNTSDPLRTVSYQVRTKMSDYEDDNTDVQSLTVEEEYELWNSNVPVMYE
Ecym_3012          ----------------------------MMEYEEIEHDESPLTVDQEYELWKSNVSLMYD
                                                               .:**.** :**.::*:

TBLA0A07120        FVSETKLVWPSLTVEWLPSN-ETTNLPSN---EQRLLLGTHTSGEEQNYLKIAEITLPDQ
KAFR0L00320        FVSETKLTWPSLTVEWLPHD------PQAPLTQQEMIIGTHTSDQEPNYVKIASIELPNE
KLLA0D00814g       FVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELLIGTLTTDNEPNYLKIAAIDLPEN
KNAG0E00980        FVSETRLVWPSLTVQWLPHS------APNPVTRQELILGTHTSDEEQNYLKIAVVDLPTE
CAGL0B03575g       FVSETRLTWPTLTVEWLPQ--KNLVAART---RQQLILGTHTSGEEQNYLKIGAVDLPVE
Smik_5.31          FVSETRLTWPSLSVQWLPTPIQEAEGGFI---RQELIIGTHTSGEEENYLKFAEINIPKE
YEL056W            FVSETRLTWPSLTVQWLPTPVQELDGGFI---KQELIIGTHTSGEEENYLKFAEINLPKE
Suva_5.12          FVSETRLTWPSLTVQWLPTPVQEPEGGFI---KQELIIGTHTSGEEENYLKFAEINLPKE
Skud_5.33          FVSETRLTWPSLTVQWLPTPVQQPKGGFI---KQELIIGTHTSGEEENYLKFAEINLPKE
NDAI0K02900        FVSETKLTWPTLTVEWLPSS-HSSTPVSN---RQELILGTHTSGEEDNYLKIAAIDLPDE
NCAS0F00190        FVSETRLTWPSLSLEWLPQE-KSAQ-APN---RQELIIGTHTSGEEDNYLKIAAIDLPND
ZYRO0F00462g       FVSETNLTWPSLTLEWLPGS-R----SSN---RQEMILGTHTSDEEQNYLKIAAIYLPDE
TDEL0G04620        FVSETNLTWPTLTLEWLPGN-S----HSN---RQELILGTHTSEEEPNYLKIAAIDLPDE
Kpol_1045.78       FVSETRLTWPSLTAQWLPGS-E----EDT---RQYMILGTHTSGEEVDYLKVAALDLPDE
TPHA0M00190        FVSETRLTWPSLTLQWLPGD-K----TST---RQHLILGTLTSGAETDYLKIAALDLPDE
SAKL0E00814g       FVSETKLTWPSLTIQWLPGN-S----SST---KQEMILGTHTSGEDDNYLKIASIELPED
KLTH0C11550g       FVSETKLLWPSLTIQWLPSN-D----RSN---EQELILGTHTSGTEQNYLKIASVHLPDE
Kwal_56.22345      FVSETRLLWPSLTIQWLPRA-E----DST---EQELLVGTHTSDSEQNYLKIAEINLPQE
ACR017W            FVSETKLTWPSLTIQWLPS--D----GQSP--EQSLIFGTHTAGEEVNYLKVATINLPAG
Ecym_3012          FVSETKLTWPSLSIQWLPSV-D----ANVPLKQQEMILGTHTSGDENNYLKIAAIDLPYE
                   *****.* **:*: :***               * ::.** *:  : :*:*.. : :*  

TBLA0A07120        IINE------------KTEDNSDKHVKSNIRIIKKFKHELEVTRAHYMPQDSTIIATING
KAFR0L00320        VI--------------DPHNVSDAPVKSNVRITKKFKLEKEITRSRYMVQDPNIISTIDG
KLLA0D00814g       VTSSKPSVSD------DAKENELSHRQSKIKIVRKFKHEQEVTRARYMPQSPNIIATLNG
KNAG0E00980        VTDTS-----------NLTESDEEQVRSNIRVTRKFKHDSEVTRARYMPQDPNILATISG
CAGL0B03575g       VTENSKKDR-------EIDEEDEDMVLSNVKIVKKFPHDGEITRARYMPQDDNIIATING
Smik_5.31          ILNNQDPQEEAE----EDDKATLNAPKSNIRITAKYVHEEEITRARYMPQNPDFVATLNG
YEL056W            ILSNEDPQEEAG----EEYQSSLPAPRSNIRITAKYEHEEEITRARYMPQDPNIVATING
Suva_5.12          ILNNEDPQEEAG----EDDEVSAPAPRSNIKITAKYKHEEEITRARYMPQNPGTVATING
Skud_5.33          VLNNENPQEQAE----MGDEASLPPPRSNIRITAKYEHEEEITRARYMPQDPNMVATING
NDAI0K02900        VVQPSTNSLKAQREDDEDEDDQKQKPRSNIKIVKKFKHEEEITRARFMPQNTDIIATING
NCAS0F00190        IIPSTEKL--------EDQQKGETTTKSNIKIIKKFKHEEEITRARYMPQNSNLVATING
ZYRO0F00462g       VVPD------------AEPKEEEEVLKSNVKIIKKFEHENEVTRARYMPQDDNLIATISG
TDEL0G04620        IVPG------------KEDRERDGFTKSNIKIIKKFKHEQEVTRARYMPQDSNLIATING
Kpol_1045.78       VVT-------------GEANDDNRRTKSNIKIVKKFEHDGEINRARYMPKDSNIIATING
TPHA0M00190        IIIG---------------KKSDKVVKSNLKVVKKFAHDGEINRARYMPQNTNIIATVNG
SAKL0E00814g       ILGAEFSETPES----TEETEQQRNVQSRIKITKKIKHEEEITRARFMPQDPNFIATING
KLTH0C11550g       VVSDVKCSAPST----DDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPNLIATISG
Kwal_56.22345      ILSNEGPVLQ------NDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPFDSNLIATISG
ACR017W            IAGLD-----------QGDEEDEANDHSSFAIANKFPHIEEVIRARYMPANSNIIATING
Ecym_3012          VVGL------------PDEDNSSEPVKSMIKVTKKFEHEDEVIRARYMPKNDKIIATING
                   :                          * . :  *     *: *:.:   .   ::*:.*

TBLA0A07120        DGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQ--
KAFR0L00320        NGTVSIFDRN---SSDS-PVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAE
KLLA0D00814g       AGIVYIFDRNIKEKDHG-AIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTST
KNAG0E00980        TGTVYIYDRS-NERDTA-SI-TLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSD
CAGL0B03575g       EGKIFIYDRS-KNGVEA-LLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNF
Smik_5.31          QGTVFLYSRS-----GG-LQSTLKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSN
YEL056W            QGTVFLYSRS-----EG-LQSTLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSG
Suva_5.12          QGTVFIYSRS-----EG-LQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGN
Skud_5.33          QGTVFLYSRS-----DG-LQSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGG
NDAI0K02900        SGTVFIYNQS-NDKQSA-LISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQEN
NCAS0F00190        SGKVFLYDRS-KDKHSG-LVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNS
ZYRO0F00462g       VGTIYLYNRA-NEVESG-LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGK
TDEL0G04620        SGTVFLYDRS-KDGDEG-LLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTN
Kpol_1045.78       EGNVSIYDRS-KSRSDG-LRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSG
TPHA0M00190        EGTIFIYDCS-RDKQSA-LLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATND
SAKL0E00814g       VGKVFLFDRS-KDKNEA-LVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGT
KLTH0C11550g       SGKVFLYDRS-KDSDSA-LTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSG
Kwal_56.22345      TGTVFLYDRT-KDDENA-LRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSG
ACR017W            KGTISIFDRT-LEESKA-QVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAA
Ecym_3012          KGKIFIYDRS-KSKSEG-LCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINST
                    * : ::.                .* :*.*.* *.      *:* :**  :. ::    

TBLA0A07120        -----KSIPLLTLQETSIINDVRWNQFNQNLFGYVTES-SCLNLKDVRNNNNDLKIVSNH
KAFR0L00320        SE---DPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDK-V-----T
KLLA0D00814g       AN--KSPSQTF-DVHTDIVNDCKWHEFQSSLFGTVSED-NTLIIHDTNS-DRAI-----Q
KNAG0E00980        RN---EPVQKWENIHSDIVNDCQWHNFQKSLFGTVSED-SSLQIHDTRE-SKPV-----A
CAGL0B03575g       EK-NIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSED-STMKLFDKRS-SQII-----H
Smik_5.31          ST-SISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSED-SLLKINDVRAHNITI-----D
YEL056W            GD-PTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSED-SLLKINDVRANNTTI-----D
Suva_5.12          SD-STRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSED-SLLKINDLRVENTTT-----G
Skud_5.33          SD-STTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSED-SLLKINDIRAENTTI-----D
NDAI0K02900        STLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSED-STLQLHDQREQNTII-----N
NCAS0F00190        NS---SPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSED-STLQLHDQREKDTFT-----S
ZYRO0F00462g       SQ---EPILTFTDRHSDIVNDCKWHNFDQNIFGSVSED-STLQLHDQRIRDAAV-----E
TDEL0G04620        ST---KPVSTWESCHQDGVNDCKWHELNGNTFGSVSED-CTLQLHDQRVKDSVT-----D
Kpol_1045.78       SK---SPKSVWDNIHSDIVNDCSWHHFDENLFGSVSED-STLKLHDKRSTSKVI-----N
TPHA0M00190        KL--KQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSED-STLQLFDKRNGGKSD-----V
SAKL0E00814g       NT---SPSKAVTT-HEDIVNDCTWHEFNENLFGSVSED-KTLQIHDKRT-NSTV-----H
KLTH0C11550g       KN---TPVKV-DTSHNNIVNECKWHEKSPFLFGSVSDD-STLIIHDKRI-DKPV-----V
Kwal_56.22345      KT---VPTSV-NSLHSDIVNECKWHESDPNIYGSVSED-SFLMIHDKRS-EKPL-----Q
ACR017W            K----KPKSILTS-HDDIVNDVKWHEFESNVFGTVSED-KTLQVHDKRVRLEPV-----K
Ecym_3012          D----RPVSIVMN-HTDIVNDSKWHEFDENIFGTVSED-KTLQVHDKRSLSNSA-----Q
                         .           :*:  *   .   :. *::.   : : * .            

TBLA0A07120        DIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHAL
KAFR0L00320        SIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDS
KLLA0D00814g       KLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPH
KNAG0E00980        TINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQ
CAGL0B03575g       NINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPN
Smik_5.31          AVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTH
YEL056W            TVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTH
Suva_5.12          TAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPH
Skud_5.33          TAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPH
NDAI0K02900        SIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPH
NCAS0F00190        QFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPD
ZYRO0F00462g       KVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQ
TDEL0G04620        KIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAA
Kpol_1045.78       TIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPK
TPHA0M00190        KISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSND
SAKL0E00814g       RLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPH
KLTH0C11550g       KILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPH
Kwal_56.22345      KLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHH
ACR017W            KLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPH
Ecym_3012          VLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSH
                           *:: **  *  ::::.*    : *:* *     :: * **   :. ::*   

TBLA0A07120        NDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLN
KAFR0L00320        VDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDA-TPELMMIHAGHRSSVNDFSLNSSIP
KLLA0D00814g       QDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDG-VPELFMMHGGHRSPVNEFSHNSNVP
KNAG0E00980        DDGIILSAGADKRVIIWDINDIGAEQVLEDAEDA-TSEVMMIHAGHRSPINDFAINPSIP
CAGL0B03575g       NDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDG-PPEVLMIHAGHKTSINDIAVNPNIN
Smik_5.31          VDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDG-VPELIMVHAGHRSSVNDFDLNAQIP
YEL056W            VDGVVVSSGSDNRLMMWDLKQIGAEQTPDDAEDG-VPELIMVHAGHRSSVNDFDLNPQIP
Suva_5.12          VDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDG-VPELIMVHAGHKSAVNDFDLNAQIP
Skud_5.33          VDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDG-VPELIMVHAGHRSAVNDFDLNAQVP
NDAI0K02900        TDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDG-APEVIMIHAGHRSAVNDFSINPNIP
NCAS0F00190        QDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDG-APEVLMIHAGHRSAINDFSMNPNIP
ZYRO0F00462g       EDGVLISAGSDRRTILWDLAEIGAEQVPDDADDG-SPEVMMIHAGHRSSINDFSMNPNIP
TDEL0G04620        KDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDG-SPEVVMIHAGHRSPVNDFSMNPNIP
Kpol_1045.78       EDGILVSGGADRRVILWDLAEIGAEQQPDEADDG-SPEILMIHAGHRSAINDFTLHPTIP
TPHA0M00190        KDGILISGSSDRRVIMWDLFEIGAEQQPDEADDG-LPEVMMIHAGSRSAINDISTHPSIP
SAKL0E00814g       KDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADG-VPELMMMHAGHKSAVNDFSFNWNIP
KLTH0C11550g       KDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDG-VPELLMMHAGHKSPVNDFSCSPNIP
Kwal_56.22345      KDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDG-GPELLMMHAGHKSAINDFSFSPNVP
ACR017W            TDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDG-APELMMMHAGHRSPVNEFSFNPQIP
Ecym_3012          KDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDG-VPELMMMHAGHRSAINDFSFNPQVP
                    **:: :.. *.*  :**: :** **  ::  *.  .*:.*:*.* .:.:*::     : 

TBLA0A07120        WLCASIEEDNIVQVWKMNNSLRE---DP-LVNMNVIR
KAFR0L00320        WLIASTEEENIIQVWKSSSRLPRISNSKPFINYDLIN
KLLA0D00814g       WLMCSVEEENVLQIWKPANKIVRPPQPPADFDITTLE
KNAG0E00980        WLVASAEEENIVQLWKCSHKLPRISGTP-PVRVDMLQ
CAGL0B03575g       WLVASAEEDNIVQIWKCSSNIPRIGGEP-EVDLSILD
Smik_5.31          WLVASSEEENILQVWKCSHNLPIVGGPP-KVNKDIIS
YEL056W            WLVASAEEENILQVWKCSHSLPIVGGPP-KVNKDIIS
Suva_5.12          WLVASTEEENILQVWKCSHSLPVVGGPP-KVSMDMIS
Skud_5.33          WLIASTEEENILQVWKCSHSLPIVGGLP-KINKDIVG
NDAI0K02900        WLMASAEEENIIQVWKCSHKLPIVGGTP-EVSVSILE
NCAS0F00190        WLMASSEEENIIQVWKCSHKLPRVGGTP-TVSVSQLE
ZYRO0F00462g       WLTATAEEENIVQVWKPSSKLPRIGGTP-SVDTQLLE
TDEL0G04620        WLMASAEEENIVQVWKCSSKLPRVGGLP-KVDDSVLE
Kpol_1045.78       WLSASVEEDNVVQVWKCSKNLSRVGGTP-EIDTKMLQ
TPHA0M00190        WLNASVEENNIVQVWKCSSKLPRISGTP-EVSISDLE
SAKL0E00814g       WLMASVEEDNIVHVWKVSKKLTSPGLIQ-DYDIRSLE
KLTH0C11550g       WLMASVEEENVVQIWKASKKLTSPYIPR-DYNIRSLE
Kwal_56.22345      WLMASVEEENIVQIWKPSRKLTNPYFPQ-GYDIRSLE
ACR017W            WLLASTEEDNVIQAWKVSMKLVNASPPA-ISDPSLLV
Ecym_3012          WLIASAEEDNVVQVWKISKKLVSNIIPE-YTDLKSLE
                   ** .: **:*::: **    :              : 

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0A07120
----------------------MSKYNTNEQKSTIKEEEEPLTTDQEYELWKSNVPLLYD
FVSETKLVWPSLTVEWLPSN-ETTNLPSN---EQRLLLGTHTSGEEQNYLKIAEITLPDQ
IINE------------KTEDNSDKHVKSNIRIIKKFKHELEVTRAHYMPQDSTIIATING
DGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAYWNIQ--
-----KSIPLLTLQETSIINDVRWNQFNQNLFGYVTES-SCLNLKDVRNNNNDLKIVSNH
DIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFHAL
NDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNNLN
WLCASIEEDNIVQVWKMNNSLRE---DP-LVNMNVIR
>KAFR0L00320
--------------------------------MGPQEEERELSIDEEYKLWKSNVPLMYD
FVSETKLTWPSLTVEWLPHD------PQAPLTQQEMIIGTHTSDQEPNYVKIASIELPNE
VI--------------DPHNVSDAPVKSNVRITKKFKLEKEITRSRYMVQDPNIISTIDG
NGTVSIFDRN---SSDS-PVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAE
SE---DPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDK-V-----T
SIEMEQPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDS
VDGILVSSSEDRRIIIWDLMEIGSEQVNEDAQDA-TPELMMIHAGHRSSVNDFSLNSSIP
WLIASTEEENIIQVWKSSSRLPRISNSKPFINYDLIN
>KLLA0D00814g
-------------------------------MTEVEEPEQPTTINEEYDLWVSNVPMMYD
FVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELLIGTLTTDNEPNYLKIAAIDLPEN
VTSSKPSVSD------DAKENELSHRQSKIKIVRKFKHEQEVTRARYMPQSPNIIATLNG
AGIVYIFDRNIKEKDHG-AIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTST
AN--KSPSQTF-DVHTDIVNDCKWHEFQSSLFGTVSED-NTLIIHDTNS-DRAI-----Q
KLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSVTSLEFSPH
QDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDG-VPELFMMHGGHRSPVNEFSHNSNVP
WLMCSVEEENVLQIWKPANKIVRPPQPPADFDITTLE
>KNAG0E00980
-----------MDLSDPKLLAAAAQLTGIDLQQLPSDENRPLDPSEEYDLWKSNVPMMYD
FVSETRLVWPSLTVQWLPHS------APNPVTRQELILGTHTSDEEQNYLKIAVVDLPTE
VTDTS-----------NLTESDEEQVRSNIRVTRKFKHDSEVTRARYMPQDPNILATISG
TGTVYIYDRS-NERDTA-SI-TLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSD
RN---EPVQKWENIHSDIVNDCQWHNFQKSLFGTVSED-SSLQIHDTRE-SKPV-----A
TINGTKPFNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQ
DDGIILSAGADKRVIIWDINDIGAEQVLEDAEDA-TSEVMMIHAGHRSPINDFAINPSIP
WLVASAEEENIVQLWKCSHKLPRISGTP-PVRVDMLQ
>CAGL0B03575g
--------------MSVQLDPSALQKMAEVAAAAEQQSNEPMTVDEEYELWKSNVPMLYD
FVSETRLTWPTLTVEWLPQ--KNLVAART---RQQLILGTHTSGEEQNYLKIGAVDLPVE
VTENSKKDR-------EIDEEDEDMVLSNVKIVKKFPHDGEITRARYMPQDDNIIATING
EGKIFIYDRS-KNGVEA-LLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIALWDISNF
EK-NIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSED-STMKLFDKRS-SQII-----H
NINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPN
NDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDG-PPEVLMIHAGHKTSINDIAVNPNIN
WLVASAEEDNIVQIWKCSSNIPRIGGEP-EVDLSILD
>Smik_5.31
--------MSQARTFLLSIVLKLTVSTTANNRAAMETQEKALSVDEEYDLWKSNVPLMYD
FVSETRLTWPSLSVQWLPTPIQEAEGGFI---RQELIIGTHTSGEEENYLKFAEINIPKE
ILNNQDPQEEAE----EDDKATLNAPKSNIRITAKYVHEEEITRARYMPQNPDFVATLNG
QGTVFLYSRS-----GG-LQSTLKFHKDNGYALSFNALVEGQLLSGSDDHTVALWEVGSN
ST-SISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSED-SLLKINDVRAHNITI-----D
AVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTNIEFSTH
VDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDG-VPELIMVHAGHRSSVNDFDLNAQIP
WLVASSEEENILQVWKCSHNLPIVGGPP-KVNKDIIS
>YEL056W
----------------------------------MENQEKPLSVDEEYDLWKSNVPLMYD
FVSETRLTWPSLTVQWLPTPVQELDGGFI---KQELIIGTHTSGEEENYLKFAEINLPKE
ILSNEDPQEEAG----EEYQSSLPAPRSNIRITAKYEHEEEITRARYMPQDPNIVATING
QGTVFLYSRS-----EG-LQSTLKFHKDNGYALSFSTLVKGRLLSGSDDHTVALWEVGSG
GD-PTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSED-SLLKINDVRANNTTI-----D
TVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNNLEFSTH
VDGVVVSSGSDNRLMMWDLKQIGAEQTPDDAEDG-VPELIMVHAGHRSSVNDFDLNPQIP
WLVASAEEENILQVWKCSHSLPIVGGPP-KVNKDIIS
>Suva_5.12
----------------------------------METQEKPLSVDEEYDLWKSNVPLMYD
FVSETRLTWPSLTVQWLPTPVQEPEGGFI---KQELIIGTHTSGEEENYLKFAEINLPKE
ILNNEDPQEEAG----EDDEVSAPAPRSNIKITAKYKHEEEITRARYMPQNPGTVATING
QGTVFIYSRS-----EG-LQSTLKFHEENGYALSFSPLVEGLLLSGSDDHTVALWDVNGN
SD-STRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSED-SLLKINDLRVENTTT-----G
TAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPH
VDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDG-VPELIMVHAGHKSAVNDFDLNAQIP
WLVASTEEENILQVWKCSHSLPVVGGPP-KVSMDMIS
>Skud_5.33
----------------------------------MEGQEKPLSVDEEYDLWKSNVPLMYD
FVSETRLTWPSLTVQWLPTPVQQPKGGFI---KQELIIGTHTSGEEENYLKFAEINLPKE
VLNNENPQEQAE----MGDEASLPPPRSNIRITAKYEHEEEITRARYMPQDPNMVATING
QGTVFLYSRS-----DG-LQSTLKFHKDNGYALSFSPLIKGHLLSGSDDHSVALWDVSGG
SD-STTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSED-SLLKINDIRAENTTI-----D
TAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTNLEFSPH
VDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDG-VPELIMVHAGHRSAVNDFDLNAQVP
WLIASTEEENILQVWKCSHSLPIVGGLP-KINKDIVG
>NDAI0K02900
-----MDQANAKLLEKLAADPSMLAQLTNQEETGNGDENKELTIDEEYDLWKSNVPLMYD
FVSETKLTWPTLTVEWLPSS-HSSTPVSN---RQELILGTHTSGEEDNYLKIAAIDLPDE
VVQPSTNSLKAQREDDEDEDDQKQKPRSNIKIVKKFKHEEEITRARFMPQNTDIIATING
SGTVFIYNQS-NDKQSA-LISTLRFHKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQEN
STLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSED-STLQLHDQREQNTII-----N
SIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDSITNLEFSPH
TDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDG-APEVIMIHAGHRSAVNDFSINPNIP
WLMASAEEENIIQVWKCSHKLPIVGGTP-EVSVSILE
>NCAS0F00190
--------------------MDALMEKMAAVQGEEEDPNKELSIDEEYELWRSNVPLMYD
FVSETRLTWPSLSLEWLPQE-KSAQ-APN---RQELIIGTHTSGEEDNYLKIAAIDLPND
IIPSTEKL--------EDQQKGETTTKSNIKIIKKFKHEEEITRARYMPQNSNLVATING
SGKVFLYDRS-KDKHSG-LVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTIALWNVNNS
NS---SPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSED-STLQLHDQREKDTFT-----S
QFKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPD
QDGILMTSGEDRRAIIWDICDIGVEQIPDDAEDG-APEVLMIHAGHRSAINDFSMNPNIP
WLMASSEEENIIQVWKCSHKLPRVGGTP-TVSVSQLE
>ZYRO0F00462g
-------------------------------MSISNPPEKPLSIDEEYDLWKSNVPLMYD
FVSETNLTWPSLTLEWLPGS-R----SSN---RQEMILGTHTSDEEQNYLKIAAIYLPDE
VVPD------------AEPKEEEEVLKSNVKIIKKFEHENEVTRARYMPQDDNLIATISG
VGTIYLYNRA-NEVESG-LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGK
SQ---EPILTFTDRHSDIVNDCKWHNFDQNIFGSVSED-STLQLHDQRIRDAAV-----E
KVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQ
EDGVLISAGSDRRTILWDLAEIGAEQVPDDADDG-SPEVMMIHAGHRSSINDFSMNPNIP
WLTATAEEENIVQVWKPSSKLPRIGGTP-SVDTQLLE
>TDEL0G04620
--------------------------------MAEEQVDKPLSIDEEYELWRSNVPLMYD
FVSETNLTWPTLTLEWLPGN-S----HSN---RQELILGTHTSEEEPNYLKIAAIDLPDE
IVPG------------KEDRERDGFTKSNIKIIKKFKHEQEVTRARYMPQDSNLIATING
SGTVFLYDRS-KDGDEG-LLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTN
ST---KPVSTWESCHQDGVNDCKWHELNGNTFGSVSED-CTLQLHDQRVKDSVT-----D
KIKTVTAFNTIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAA
KDGIVMSSGEDRRVIMWDLMEIGAEQVPDDADDG-SPEVVMIHAGHRSPVNDFSMNPNIP
WLMASAEEENIVQVWKCSSKLPRVGGLP-KVDDSVLE
>Kpol_1045.78
-------------------------------MEAQREQEEPLTVDQEYELWKTNVPLMYD
FVSETRLTWPSLTAQWLPGS-E----EDT---RQYMILGTHTSGEEVDYLKVAALDLPDE
VVT-------------GEANDDNRRTKSNIKIVKKFEHDGEINRARYMPKDSNIIATING
EGNVSIYDRS-KSRSDG-LRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIALWDIDSG
SK---SPKSVWDNIHSDIVNDCSWHHFDENLFGSVSED-STLKLHDKRSTSKVI-----N
TIQAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPK
EDGILVSGGADRRVILWDLAEIGAEQQPDEADDG-SPEILMIHAGHRSAINDFTLHPTIP
WLSASVEEDNVVQVWKCSKNLSRVGGTP-EIDTKMLQ
>TPHA0M00190
-------------------------------MEKVEQQEEPLTVDQEYDLWKSNVPLLYD
FVSETRLTWPSLTLQWLPGD-K----TST---RQHLILGTLTSGAETDYLKIAALDLPDE
IIIG---------------KKSDKVVKSNLKVVKKFAHDGEINRARYMPQNTNIIATVNG
EGTIFIYDCS-RDKQSA-LLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATND
KL--KQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSED-STLQLFDKRNGGKSD-----V
KISSKGQYNSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSND
KDGILISGSSDRRVIMWDLFEIGAEQQPDEADDG-LPEVMMIHAGSRSAINDISTHPSIP
WLNASVEENNIVQVWKCSSKLPRISGTP-EVSISDLE
>SAKL0E00814g
--------------------------------MSIEEENKLLSIEEEYELWKTNVPLMYD
FVSETKLTWPSLTIQWLPGN-S----SST---KQEMILGTHTSGEDDNYLKIASIELPED
ILGAEFSETPES----TEETEQQRNVQSRIKITKKIKHEEEITRARFMPQDPNFIATING
VGKVFLFDRS-KDKNEA-LVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIALWNVMGT
NT---SPSKAVTT-HEDIVNDCTWHEFNENLFGSVSED-KTLQIHDKRT-NSTV-----H
RLTLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPH
KDGILCSSGSDRRVLLWDLMQIGSEQAQEDAADG-VPELMMMHAGHKSAVNDFSFNWNIP
WLMASVEEDNIVHVWKVSKKLTSPGLIQ-DYDIRSLE
>KLTH0C11550g
--------------------------------MQATIPENEVSVDEEYDLWKSNVPLMYD
FVSETKLLWPSLTIQWLPSN-D----RSN---EQELILGTHTSGTEQNYLKIASVHLPDE
VVSDVKCSAPST----DDSKESGHQPQSKIKIVRKFEHRDEVTRARYAPFNPNLIATISG
SGKVFLYDRS-KDSDSA-LTAEFSFHKENGYGLNFSVISPGELLSCSDDGSIAIWDVCSG
KN---TPVKV-DTSHNNIVNECKWHEKSPFLFGSVSDD-STLIIHDKRI-DKPV-----V
KILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPH
KDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDG-VPELLMMHAGHKSPVNDFSCSPNIP
WLMASVEEENVVQIWKASKKLTSPYIPR-DYNIRSLE
>Kwal_56.22345
--------------------------------MQSTEPERELSIDDEYDLWKSNVPLMYD
FVSETRLLWPSLTIQWLPRA-E----DST---EQELLVGTHTSDSEQNYLKIAEINLPQE
ILSNEGPVLQ------NDNNGSDEQVPSKIKIIKKFKHENEVTRARYAPFDSNLIATISG
TGTVFLYDRT-KDDENA-LRGKYAYHKENGYGLNFSVASPGELISCSDDGSIAIWDIKSG
KT---VPTSV-NSLHSDIVNECKWHESDPNIYGSVSED-SFLMIHDKRS-EKPL-----Q
KLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAHH
KDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDG-GPELLMMHAGHKSAINDFSFSPNVP
WLMASVEEENIVQIWKPSRKLTNPYFPQ-GYDIRSLE
>ACR017W
MTTKLKGLKELGNTSDPLRTVSYQVRTKMSDYEDDNTDVQSLTVEEEYELWNSNVPVMYE
FVSETKLTWPSLTIQWLPS--D----GQSP--EQSLIFGTHTAGEEVNYLKVATINLPAG
IAGLD-----------QGDEEDEANDHSSFAIANKFPHIEEVIRARYMPANSNIIATING
KGTISIFDRT-LEESKA-QVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAA
K----KPKSILTS-HDDIVNDVKWHEFESNVFGTVSED-KTLQVHDKRVRLEPV-----K
KLPTASPFNTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPH
TDGIICSSGSDRRAIIWDLTQIGAEQSQDDADDG-APELMMMHAGHRSPVNEFSFNPQIP
WLLASTEEDNVIQAWKVSMKLVNASPPA-ISDPSLLV
>Ecym_3012
----------------------------MMEYEEIEHDESPLTVDQEYELWKSNVSLMYD
FVSETKLTWPSLSIQWLPSV-D----ANVPLKQQEMILGTHTSGDENNYLKIAAIDLPYE
VVGL------------PDEDNSSEPVKSMIKVTKKFEHEDEVIRARYMPKNDKIIATING
KGKIFIYDRS-KSKSEG-LCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDINST
D----RPVSIVMN-HTDIVNDSKWHEFDENIFGTVSED-KTLQVHDKRSLSNSA-----Q
VLPVEKPLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSH
KDGILCSSGSDRRLFIWDLTQIGAEQAQEDADDG-VPELMMMHAGHRSAINDFSFNPQVP
WLIASAEEDNVVQVWKISKKLVSNIIPE-YTDLKSLE