MUSCLE (3.8) multiple sequence alignment

Suva_5.11       MANGGIQKND-GTTGSKTVLFWTCSKEIDIIMKKISFLERNITKQLDTLPLFPKTLPPNH
Skud_5.32       MANGGIQKND-NTTNFKVAQFSTYSKEIEIIMKKITFLERNITQQLDTLPHFPKTLPPSH
Smik_5.30       MVNDGIQRNDFNEKELKTVRFSAYSKEIDVIMRKISFLEKNITQQLYTLPHFPKTLPPNH
YEL057C         MANDGIQRND-NRKGFKTVQFSAYSKEIDVIMKKISFLERNITQQLDTLPHFPKTLPPNH
                *.*.***.** . .  *.. * : ****::**.**:***.***:** *** *******.*

Suva_5.11       ETRINRTRRTKGSWGTQLKNLLGIYSRDEISTLDNLAATLHDQVLKLQAKLFPIAILKQV
Skud_5.32       KTCRCRTSKPRESWSNQLKNLLGIYSKEEISTLDNLAATLHDQVLKLQAKLFPIAILKQV
Smik_5.30       KTGVRRTNRTKENWSNQLNNLLGIYSKDEIFTLDSLAATLHDQVLRLQSTLFPIAILEQV
YEL057C         KDCVSRKHRARRGWSSQLKNLLGIYSKEEIFTLDNLAATLHDQVLKLQATLFPNAILKQV
                :    *. ... .*..**:*******.:** ***.**********.**:.*** ***:**

Suva_5.11       HLNKDNVENKKILKEITYEYLSKKNCQRESKFGAFIVRRIFFGDLSLGVSILVNRIAFET
Skud_5.32       HLDNNNVENRKILKEVTYEYLSKENCQRERKFGAFIVKRIFFGDLSLGVSILVNRVTFET
Smik_5.30       HLNNDNVENKKLLKEITYEYLSKENCGGANKFGTFIIKRIFFGDLSLGISILVNRTTFET
YEL057C         HLDNANIENKRILKEITYKYLSNENCKEENKFGTFIVKRIFFGDLSLGVSVLINRIAFES
                **:: *:**..:***:**:***::**    ***:**:.**********:*:*:** :**:

Suva_5.11       VGSSIVVVRSSFIENDFLYEDYLIWGGGMKRRKKFKRKIVFISTTINFNYQTKV
Skud_5.32       VTSSIVIVSSSFIENDFFYEDYLILGCKVRRRKKFKRKILFISNTINFNYQTKV
Smik_5.30       VTSSIIVVRSSFIENDFLYEDYLIFDCNVKRREKFKRKILFISTTINFNYQTKV
YEL057C         ATSSIMVVRSSFIESDFFYEDYLIFDCRAKRRKKLKRKILFISTTMNFNYQTKV
                . ***::* *****.**:****** .   .**:*:****:***.*:********

FASTA FORMAT for MUSCLE Version 3.6

>Suva_5.11
MANGGIQKND-GTTGSKTVLFWTCSKEIDIIMKKISFLERNITKQLDTLPLFPKTLPPNH
ETRINRTRRTKGSWGTQLKNLLGIYSRDEISTLDNLAATLHDQVLKLQAKLFPIAILKQV
HLNKDNVENKKILKEITYEYLSKKNCQRESKFGAFIVRRIFFGDLSLGVSILVNRIAFET
VGSSIVVVRSSFIENDFLYEDYLIWGGGMKRRKKFKRKIVFISTTINFNYQTKV
>Skud_5.32
MANGGIQKND-NTTNFKVAQFSTYSKEIEIIMKKITFLERNITQQLDTLPHFPKTLPPSH
KTCRCRTSKPRESWSNQLKNLLGIYSKEEISTLDNLAATLHDQVLKLQAKLFPIAILKQV
HLDNNNVENRKILKEVTYEYLSKENCQRERKFGAFIVKRIFFGDLSLGVSILVNRVTFET
VTSSIVIVSSSFIENDFFYEDYLILGCKVRRRKKFKRKILFISNTINFNYQTKV
>Smik_5.30
MVNDGIQRNDFNEKELKTVRFSAYSKEIDVIMRKISFLEKNITQQLYTLPHFPKTLPPNH
KTGVRRTNRTKENWSNQLNNLLGIYSKDEIFTLDSLAATLHDQVLRLQSTLFPIAILEQV
HLNNDNVENKKLLKEITYEYLSKENCGGANKFGTFIIKRIFFGDLSLGISILVNRTTFET
VTSSIIVVRSSFIENDFLYEDYLIFDCNVKRREKFKRKILFISTTINFNYQTKV
>YEL057C
MANDGIQRND-NRKGFKTVQFSAYSKEIDVIMKKISFLERNITQQLDTLPHFPKTLPPNH
KDCVSRKHRARRGWSSQLKNLLGIYSKEEIFTLDNLAATLHDQVLKLQATLFPNAILKQV
HLDNANIENKRILKEITYKYLSNENCKEENKFGTFIVKRIFFGDLSLGVSVLINRIAFES
ATSSIMVVRSSFIESDFFYEDYLIFDCRAKRRKKLKRKILFISTTMNFNYQTKV