MUSCLE (3.8) multiple sequence alignment

KAFR0L00350        MAPMIRVMDGDAA----------EREV--KGAEGCQLYSLVQYNCEYRVG--GTLECFPF
TBLA0G00990        MAPPVTIQTKEEL-DILEKVNRKNRKDDTKKSAKPKKYSITQYECFDNDK--GQIECFPF
KNAG0E00930        MAPNVRVLTRNDV-----------PLP--QPQDGCVLKELVQFRCENDGT---QWQCAPF
NCAS0F00210        MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRQFQLTQFQCQLLED--GQYICFPF
TPHA0M00220        MAPATPVVDREAV----AAT---LQASKQRNRQECELKALTQYECQFVDLESNRYICRPF
ZYRO0F00528g       MAPPTPILTSEQV----SRERERVQIL--KEKNKCELKSLTQHLCHAEAP--GEYICVPF
Smik_5.28          MAPPTTIRSRDQA----L-----APLMALDSQASCQLKELVQWECQFKGA---DYVCSPF
Skud_5.30          MAPPTTIRSRDQA----L-----APLAALDSHTRCQLKELVQWECQFREA---DYVCFPF
Suva_5.9           MAPPTTIRARDQA----L-----APLATLDSRTHCHLKELVQWECQFKGA---DYVCSPF
YEL059C-A          MAPPTTIRTRDQA----L-----APLATLDSQTNCRLKELVQWECQFKGA---EYVCSPF
TDEL0G04590        MAPPTPVLAREEL-----------PEI--PQSKNCVLKSLTQFQCQLRPAGSGLYECVPF
KLLA0D00880g       MAPPTKILGLDTQ----------QRML--QRGENCSLKSLVQNECAFNGN---DYVCTPF
Kpol_1032.3        MAPPTPIQSREEV----LRGKKCLTMVD-NKKGKCTLTSITQFQCRFENSYEGEYICLPF
Kwal_56.22359      MAPPTVVFGKEEL----------EPLLR-NVMATCIFKSLTQSECNFDGH---QYVCVPF
KLTH0C11484g       MAPPTLVFGKEEL----------KGIWE-KAAEPCFLKALVQNECEFNGH---EYVCTPF
SAKL0E00924g       MAPPTPVFGKDEL----------ESLLK-KVKPPCTLKSLIQNECTFNGE---EYICVPF
ACR014C            MAPPTPVLTREEV----------APAL--ATSRDCVLASLTQNECHFDGR---GYVCVPF
Ecym_3015          MAPPTPIITRDEV----------EPIL--SRTKDCILASLIQNECHFDGH---NYVCIPF
                   ***   :   :                            : *  *           * **

KAFR0L00350        KRMFLECLDKS-------GKLKRVETRSGSCK----------------------------
TBLA0G00990        KRIFQQVGEY------------RREITDETTNM---------------------------
KNAG0E00930        RRLFEQCPSQEGTNKGKCVATKRYEVTGDTTTTTTSRTNPKSPQTTTGNTARDRKSTSHT
NCAS0F00210        KRVFQECQG------------VRTEVTNVDSNM---------------------------
TPHA0M00220        KRLFEVCAGT------------SYETTAQPTNSADRS-----------------------
ZYRO0F00528g       KRVFEKCLGH------------ALEVTDADTNDIQGS-----------------------
Smik_5.28          KRLFEHCVEHG-------KPATNYEVTDTYTNS---------------------------
Skud_5.30          KRLFERCIAPD-------KSATDYEVTDTYTNS---------------------------
Suva_5.9           RRLFEHCTAPG-------EAATNYEVTDTYTN----------------------------
YEL059C-A          KRLFEHCIAPD-------KSATNYEVTDTYTNS---------------------------
TDEL0G04590        KRLFQECRDPSG------RFKSRIEVTSPLTNH---------------------------
KLLA0D00880g       KRLFEQCMVKD-------GRVLNIEVTNLNTNR---------------------------
Kpol_1032.3        KRLFEECSG------------IRIEVTDRFTNNDK-------------------------
Kwal_56.22359      KRVFKECKVD--------GKSIRIEVTDRNTNK-AKADEMVDSFWNSRKSFTRN------
KLTH0C11484g       KRLFKECGAG--------KRIVRIEVTDQDTNH-LAFDATVTRFWESSRRCT--------
SAKL0E00924g       KRLFKECLLDSKTKDGRTSRTVRIEITDRHTNDGILEDQMVKRFWEADLHQ---------
ACR014C            QRLFRECTLN--------KRRVRIEITERNTNM---------------------------
Ecym_3015          KRLFEECTLN--------KRRVRIEVTDISTNQ---------------------------
                   .*:*                    *      .                            

KAFR0L00350        -----
TBLA0G00990        -----
KNAG0E00930        TKPST
NCAS0F00210        -----
TPHA0M00220        -----
ZYRO0F00528g       -----
Smik_5.28          -----
Skud_5.30          -----
Suva_5.9           -----
YEL059C-A          -----
TDEL0G04590        -----
KLLA0D00880g       -----
Kpol_1032.3        -----
Kwal_56.22359      -----
KLTH0C11484g       -----
SAKL0E00924g       -----
ACR014C            -----
Ecym_3015          -----
                        

FASTA FORMAT for MUSCLE Version 3.6

>KAFR0L00350
MAPMIRVMDGDAA----------EREV--KGAEGCQLYSLVQYNCEYRVG--GTLECFPF
KRMFLECLDKS-------GKLKRVETRSGSCK----------------------------
-----
>TBLA0G00990
MAPPVTIQTKEEL-DILEKVNRKNRKDDTKKSAKPKKYSITQYECFDNDK--GQIECFPF
KRIFQQVGEY------------RREITDETTNM---------------------------
-----
>KNAG0E00930
MAPNVRVLTRNDV-----------PLP--QPQDGCVLKELVQFRCENDGT---QWQCAPF
RRLFEQCPSQEGTNKGKCVATKRYEVTGDTTTTTTSRTNPKSPQTTTGNTARDRKSTSHT
TKPST
>NCAS0F00210
MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRQFQLTQFQCQLLED--GQYICFPF
KRVFQECQG------------VRTEVTNVDSNM---------------------------
-----
>TPHA0M00220
MAPATPVVDREAV----AAT---LQASKQRNRQECELKALTQYECQFVDLESNRYICRPF
KRLFEVCAGT------------SYETTAQPTNSADRS-----------------------
-----
>ZYRO0F00528g
MAPPTPILTSEQV----SRERERVQIL--KEKNKCELKSLTQHLCHAEAP--GEYICVPF
KRVFEKCLGH------------ALEVTDADTNDIQGS-----------------------
-----
>Smik_5.28
MAPPTTIRSRDQA----L-----APLMALDSQASCQLKELVQWECQFKGA---DYVCSPF
KRLFEHCVEHG-------KPATNYEVTDTYTNS---------------------------
-----
>Skud_5.30
MAPPTTIRSRDQA----L-----APLAALDSHTRCQLKELVQWECQFREA---DYVCFPF
KRLFERCIAPD-------KSATDYEVTDTYTNS---------------------------
-----
>Suva_5.9
MAPPTTIRARDQA----L-----APLATLDSRTHCHLKELVQWECQFKGA---DYVCSPF
RRLFEHCTAPG-------EAATNYEVTDTYTN----------------------------
-----
>YEL059C-A
MAPPTTIRTRDQA----L-----APLATLDSQTNCRLKELVQWECQFKGA---EYVCSPF
KRLFEHCIAPD-------KSATNYEVTDTYTNS---------------------------
-----
>TDEL0G04590
MAPPTPVLAREEL-----------PEI--PQSKNCVLKSLTQFQCQLRPAGSGLYECVPF
KRLFQECRDPSG------RFKSRIEVTSPLTNH---------------------------
-----
>KLLA0D00880g
MAPPTKILGLDTQ----------QRML--QRGENCSLKSLVQNECAFNGN---DYVCTPF
KRLFEQCMVKD-------GRVLNIEVTNLNTNR---------------------------
-----
>Kpol_1032.3
MAPPTPIQSREEV----LRGKKCLTMVD-NKKGKCTLTSITQFQCRFENSYEGEYICLPF
KRLFEECSG------------IRIEVTDRFTNNDK-------------------------
-----
>Kwal_56.22359
MAPPTVVFGKEEL----------EPLLR-NVMATCIFKSLTQSECNFDGH---QYVCVPF
KRVFKECKVD--------GKSIRIEVTDRNTNK-AKADEMVDSFWNSRKSFTRN------
-----
>KLTH0C11484g
MAPPTLVFGKEEL----------KGIWE-KAAEPCFLKALVQNECEFNGH---EYVCTPF
KRLFKECGAG--------KRIVRIEVTDQDTNH-LAFDATVTRFWESSRRCT--------
-----
>SAKL0E00924g
MAPPTPVFGKDEL----------ESLLK-KVKPPCTLKSLIQNECTFNGE---EYICVPF
KRLFKECLLDSKTKDGRTSRTVRIEITDRHTNDGILEDQMVKRFWEADLHQ---------
-----
>ACR014C
MAPPTPVLTREEV----------APAL--ATSRDCVLASLTQNECHFDGR---GYVCVPF
QRLFRECTLN--------KRRVRIEITERNTNM---------------------------
-----
>Ecym_3015
MAPPTPIITRDEV----------EPIL--SRTKDCILASLIQNECHFDGH---NYVCIPF
KRLFEECTLN--------KRRVRIEVTDISTNQ---------------------------
-----