MUSCLE (3.8) multiple sequence alignment

CAGL0E02651g       -------------------------------MFSFYLITSVYYFWIFTSVDAATIPVDLS
Smik_15.172        ----------------------------------MKF-STILPILW-ASCNLCMIIPEF-
YOR003W            ----------------------------------MKF-STILPILW-ANCCLCMIIPDF-
Skud_15.164        ----------------------------------MNMKLFNILLILCAGGTLCMIIPELN
Suva_15.178        ----------------------------------MKLLTVLLALC--AGCGVCMIIPGLD
Kpol_1045.75       --------------------------------------MLFLVFLTLLNFCHALVLPEE-
KAFR0L00360        ----------------------------------MQLLIHLLLVC--STLVNALVIPSLK
TPHA0M00230        MLGGSVHSSARVSLSWPRYNYTTTIHNYHTQLYNMKLQNTLVSAVIAASVAEALVIPALD
KNAG0E00920        ----------------------------------MKITQPVLWAVALNRVAEALVLPEIR
ZYRO0C07942g       ----------------------------------MKFQKSVIPVATLAGLGSALIIPEL-
Ecym_3018          ----------------------------------MKVQSVVLPVAVFSTLGAALILPWM-
ACR012C            ----------------------------------MKLQRAVWPAVALTTAQALLILPQA-
Kpol_1032.5        ----------------------------------MKLDKTLVSVATLATLGSSLVIPEF-
NDAI0K02880        ----------------------------------MK--KTIHKNEKRRNDREYPFEKQEE
TBLA0A07300        ----------------------------------MKLEKTSLVSLATISVASSFLIPAD-
NCAS0F00220        ----------------------------------MKIEKTVLPIAALAALGSALVIPNLA
CAGL0B03619g       ------------------------------------------------------------
Suva_5.7           ----------------------------------MKLQNTLFTLGALGGISAALVIPNLE
YEL060C            ----------------------------------MKLENTLFTLGALGSISAALVIPNLE
Skud_5.29          ----------------------------------MKLENTLLTLGALGSISAALVIPNLE
Smik_5.27          ----------------------------------MKLENTLFTLGALGSISAALVIPNLE
KLLA0D00979g       ----------------------------------MKFENTLLTITALSTVATALVIPEVN
TDEL0G04550        ----------------------------------MRFEQTVLPVAALASLGAALVIPELK
SAKL0E01012g       ----------------------------------MKVQSTILPIAALTTLAAALVIPEV-
KLTH0C11396g       ----------------------------------MKL-QTALPVAVVASVGAALVLPDLE
Kwal_56.22387      ----------------------------------MKL-QTTLPVAMVAALASALVLPEV-
KAFR0B06550        ----------------------------------MNPLLFWYTSFVLTGGCLSLLLPEIF
NDAI0I02280        ----------------------------------MTLGGTLLILSWFARSITSLIIPEII
NCAS0D02630        ----------------------------------MKLLR-LISICLLTRIGYSLVIPSIW
                                                                               

CAGL0E02651g       HRESASHDYTLIN-----------------------------------------------
Smik_15.172        -DEIVRFTQITDD-----------------------------------------------
YOR003W            -DGIVRFIENIDG-----------------------------------------------
Skud_15.164        EIAYYSETFENFR-----------------------------------------------
Suva_15.178        EIVYLTESIEDFR-----------------------------------------------
Kpol_1045.75       ------------------------------------------------------------
KAFR0L00360        DSIDKFSDDIHGL-----------------------------------------------
TPHA0M00230        QGRGRGHALDHGP-------------------------------NNNNNVPAFMMRAAAA
KNAG0E00920        DERGVSQGEHGGR---------------------------------RHDVEEHGRRGRPH
ZYRO0C07942g       ----TGSNEYEKR-------------------------------PERTDDVNNGESVVA-
Ecym_3018          DPEIRLDVGLHGR-------------------------------GPHGRVPPPHHHKMGE
ACR012C            -----EDELVVAE--------------------------------------AHRGQLVQW
Kpol_1032.5        -ARDLDDKKLLAKVGNPKDEGVVLGSRRGGVECGTVAVKLDFGSNKKGKIVKKVHHVESG
NDAI0K02880        HKKKHKKDKKKKH-------------------------------HKPPHHPPKPPHHPYD
TBLA0A07300        -ERMLRDKLVPQH-------------------------------GKAGADAEHAKHKGGQ
NCAS0F00220        KEDKDKLAINNKK------------------------------FNDITDVVAKYSEQIIE
CAGL0B03619g       ------------------------------------------------------------
Suva_5.7           DTADHRELMGKED------------------------------------HHDGPKHAEFV
YEL060C            NAADHHELINKED------------------------------------HHERPRKVEFT
Skud_5.29          HAADHHELVVEDN------------------------------------HQERVGHAVHA
Smik_5.27          NAADNHELVSKDK------------------------------------DQETSGNLKFA
KLLA0D00979g       RENKHGDKSVAIK-------------------------------DHASSDLDKPQHHANG
TDEL0G04550        GKVLCHGKDKALD-------------------------------HPKDKALDHPRERPQH
SAKL0E01012g       DKSSKDVSVKEIN--------------------------------------SDSQEVLAS
KLTH0C11396g       EASNTVALKVKDV-------------------------------------ITAGESIVSS
Kwal_56.22387      -EEASKDALVAVE----------------------------------ETAASLGESILSS
KAFR0B06550        QCRGIETISQKDR-----------------------------------------------
NDAI0I02280        HSGNNDASHAKLN-----------------------------------------------
NCAS0D02630        AQTGKSPGVFNID-----------------------------------------------
                                                                               

CAGL0E02651g       ------------------------------------------------------------
Smik_15.172        ------------------------------------------------------------
YOR003W            ------------------------------------------------------------
Skud_15.164        ------------------------------------------------------------
Suva_15.178        ------------------------------------------------------------
Kpol_1045.75       ------------------------------------------------------------
KAFR0L00360        ------------------------------------------------------------
TPHA0M00230        PASA--------------------------------------------------------
KNAG0E00920        HGPKH-------------------------------------------------------
ZYRO0C07942g       ------------------------------------------------------------
Ecym_3018          HG----------------------------------------------------------
ACR012C            MA----------------------------------------------------------
Kpol_1032.5        DESDESDDDEDDHHHGKHGKHGKHGKHGKHGHHHDDDDEDDHHHGKHGKHGKHGHHHDDD
NDAI0K02880        APHDGLDHKLPHHPYDAPHDGLDHKLPHHPYDAPHDGLDHKLPHHPYDAPHDGLDHKYPP
TBLA0A07300        HSVVKHNSA---------------------------------------------------
NCAS0F00220        SA----------------------------------------------------------
CAGL0B03619g       ------------------------------------------------------------
Suva_5.7           EDNDRHDER-------PPHKKGRKE--RKDVESKDKDDEDRHARKHRKGEHMDAKDDSSD
YEL060C            KDDDEEPSDSEDKEHGKFHKKGRKGQDKESPEFNGKRASGSHGSAHEGGKGMKPKHESSN
Skud_5.29          GGSSHESAK-------ESHEDGKHG------------------------------DEEAS
Smik_5.27          SGDGEKSIK-------KGHSGGGHG--------------GSHRNGHTGGKGTKSEEGESS
KLLA0D00979g       KA----------------------------------------------------------
TDEL0G04550        RGPRRGPRRGPPPPLP--------------------------------------------
SAKL0E01012g       FA----------------------------------------------------------
KLTH0C11396g       FS----------------------------------------------------------
Kwal_56.22387      FS----------------------------------------------------------
KAFR0B06550        ------------------------------------------------------------
NDAI0I02280        ------------------------------------------------------------
NCAS0D02630        ------------------------------------------------------------
                                                                               

CAGL0E02651g       ---------RLLNLWRGKGIE---------------------------------------
Smik_15.172        ---------SRNTKSLKNLRQ---------------------------------------
YOR003W            ---------TRSVRAGEGLGQ---------------------------------------
Skud_15.164        -----------NAKAQDGLGQ---------------------------------------
Suva_15.178        -----------NAKGQEGLGQ---------------------------------------
Kpol_1045.75       ------------------------------------------------------------
KAFR0L00360        ---------LDSAKFS--------------------------------------------
TPHA0M00230        ---------MEMVKDVTDQIL---------------------------------------
KNAG0E00920        ---------EKDEHRPCKHGKEAHDEE---------------------------------
ZYRO0C07942g       ---------TSFEKGPSKDEL---------------------------------------
Ecym_3018          ---------RGRGKGHHRGSS---------------------------------------
ACR012C            ---------RENQERKAQGAE---------------------------------------
Kpol_1032.5        DEDD-----HHHGKHGKHGKHGKHGHH----------------HDDDSKPSDGRKHNPPK
NDAI0K02880        STSSSQGSSPQATSHPPHDGPHDGPHHKPPHPPHDGPHDGPHDGPHHKRPDDNKQVSNDK
TBLA0A07300        ---------KHHKQSRKQMRVHKHDDS---------------------------------
NCAS0F00220        ---------RKIGKSVQDSVNLKMAPL---------------------------------
CAGL0B03619g       ------------------------------------------------------------
Suva_5.7           DED------KPHGKGGCHGKK-DMKAK--------GKKHHEKESVEDKEHHGEESEKGKK
YEL060C            DDDNDDKKKKPHHKGGCHENKVEEKKM-----------------------------KGKK
Skud_5.29          KSDD-----KAHRKGGCHDKK-DKKDK-----------------------------KDKK
Smik_5.27          DDED-----KPHRKGGCHDKK-KKKGK-----------------------------KGKK
KLLA0D00979g       ---------RSKSRGRCADSK---------------------------------------
TDEL0G04550        ---------EGRHDGPSHEGHHDALPE---------------------------------
SAKL0E01012g       ---------KEITRAAAEKGE---------------------------------------
KLTH0C11396g       ---------KQMTKDAASKGE---------------------------------------
Kwal_56.22387      ---------KEVTKKAAESGA---------------------------------------
KAFR0B06550        ------------------------------------------------------------
NDAI0I02280        ---------ERDTLDK--------------------------------------------
NCAS0D02630        ------------------------------------------------------------
                                                                               

CAGL0E02651g       -----------------------------------------YNFNTGSKIYFDSAKN---
Smik_15.172        -----------------------------------------QYSGGFLMGGLDNTHK---
YOR003W            -----------------------------------------HDPGNFHTEHQHVAHK---
Skud_15.164        -----------------------------------------QNIENLHLGRQKVLRG---
Suva_15.178        -----------------------------------------QETGNFHLQEPKVVYK---
Kpol_1045.75       ----------------------------------------VRPASLITPN----------
KAFR0L00360        -----------------------------------------SLAPVHN------ADA---
TPHA0M00230        ------------------AYYQHASPASRGL----------ELAALHDNGVGTADHD---
KNAG0E00920        -----------------------------------------ELAPLYTPGSALSASS---
ZYRO0C07942g       --------------------AVFASKLTQEV--------QDRFAPLVV-----PEDT---
Ecym_3018          --------------------VLLVDDEEDKVSPMFEYFEFDSSQDFVDMKLASLSDN---
ACR012C            -----------------------------------------QQSPLFR-----VDDV---
Kpol_1032.5        QPVYNIKEDDDIVDSVTQQIFESAEKSGEKV----------KYAPLHSMENTKYENL---
NDAI0K02880        YSDIFHKYSKQIIESARKLKDNTPNAAGKDQDQDDQDDQDIKLAPLITPTFGDDIHTQGF
TBLA0A07300        ----------------DSGSDSDSGSDSDGDGDGDGDGDGNYESPAIAPLYSQSLHP---
NCAS0F00220        --------------------------------------VTPTPYPVVSGASANSNAN---
CAGL0B03619g       ------------------------------------------------------------
Suva_5.7           AKGKKHHGKELEKGKEHHGKKHHGKELEKGKEPHGKDHHRGKLAPLVSTEQFNPDAI---
YEL060C            VK----------------GKKHHEKTLEKGR-------HHNRLAPLVSTAQFNPDAI---
Skud_5.29          VKSKKEKKVKSKKEKKVKSKKHHEKTLEKAR-------HNEKLAPLVSTAQFDPAAM---
Smik_5.27          VK----------------SKKHDGKTLEKGR-------PNNKLAPLVSTAQFNPDAI---
KLLA0D00979g       --------------------------------------KFDKLRPVDDASAILAPLSTVN
TDEL0G04550        -----------------------------------------HRGIVHKMGEGVAPLS---
SAKL0E01012g       ---------------------------------------EVKLAPLVS-----SPQP---
KLTH0C11396g       ---------------------------------------SVELSPLVSSSGK--------
Kwal_56.22387      ---------------------------------------GVTLSPLVT-----ARNM---
KAFR0B06550        ---------------------------------------DSTFSRTEVLEHLSAKQN---
NDAI0I02280        -----------------------------------------NQIPFIIPTHGPQKNF---
NCAS0D02630        -----------------------------------------SDSPSNI-----IHHA---
                                                                               

CAGL0E02651g       --DMIIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSI--FLQDSDFGKATQY-------
Smik_15.172        --TELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSS-------
YOR003W            --TEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVISS-------
Skud_15.164        --SKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSA-------
Suva_15.178        --AESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSA-------
Kpol_1045.75       --SEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTS-------
KAFR0L00360        --ENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDI-------
TPHA0M00230        --------RYIIVFKKGVFKEQVDQHLKMMSAL----FRRLSEEQRPAAAPGA-------
KNAG0E00920        ----SRSNKYIILFKEGVTAEQISAHKQLLQQVLLETS----------------------
ZYRO0C07942g       --LGVLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFFEGIRL-------
Ecym_3018          --SRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEG-------
ACR012C            --TRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRG-------
Kpol_1032.5        ----VIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYASVSDETSS--------------
NDAI0K02880        KHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPHHHFFHSTSE-------
TBLA0A07300        --QNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEG-------
NCAS0F00220        --SNIIPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFFSASAI-------
CAGL0B03619g       ----MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNA-------
Suva_5.7           --TKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFISTRD-------
YEL060C            --SKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKD-------
Skud_5.29          --PKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAFFISTRD-------
Smik_5.27          --SKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRD-------
KLLA0D00979g       DIANKIPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSG-------
TDEL0G04550        IPPNAFPHRYIVVLKHS-SPEEIALHMEAITQSQLQSVGELAQDDPFFSAQGV-------
SAKL0E01012g       --ANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAATKG-------
KLTH0C11396g       --YLAIPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDF
Kwal_56.22387      --YDAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMD-------
KAFR0B06550        ---DIIKDQYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDH-------------
NDAI0I02280        -----IPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNY-------------
NCAS0D02630        --ASPIPNQYIVLFKSDTTDIQRETHLATLNSW-------LLNTDPQYT-----------
                           .*:: :           .   :                              

CAGL0E02651g       -------NDISTRGIGLQHEFSIGRSMTGYIGYF-TETTAKFIANS-----PLVELVEHD
Smik_15.172        ------SIAPDLQLGGIDSSFDINGLFRGYAGYF-TDEILNLVSQD-----PLIKFIEQE
YOR003W            ------SVSSKSQFGGIDNFFDINGLFRGYTGYF-TDEIIKIISQD-----PIIKFVEQE
Skud_15.164        ------SASPNPQFGGIDISFDINGLFRGYTGYF-TDEVIEIVFQD-----PLVKFIEHE
Suva_15.178        --------PSDLQFGGIDSFFDINGLFRGYTGYF-TEEVIKRVLQD-----PIIKFIEQE
Kpol_1045.75       -----SDVNSNGLLGGVRDMFKIGNDLHGYTGMF-TDEVVEFLRLS-----PLVKFIERD
KAFR0L00360        ----NVPESMRQSLGGIVSDFDISSLLSGYIAYL-SDELLHFIRLN-----PLIAFIEHD
TPHA0M00230        -------SALRDGFDRVMDTFEVAGAFSGYIATVASPKIVDFIRLN-----PLVDYVEKD
KNAG0E00920        ------DVSAQGIVADVLDSFDLEGVLSGYVAEL-SPMVLELVRRS-----PFVQLVEQD
ZYRO0C07942g       ------DGVYDSPLGGIDHTFDINGMLMGYSGYF-PSKVLDVIRMS-----PLIEMVEQD
Ecym_3018          --MHHEGISARSVEGGIEEMFEIAGSLRGYFGYF-TDGMLDLIRES-----GLVKLIEQD
ACR012C            -ENNEFGIAATRAEGGIEGEFALGEQLRGYVGYF-TEDMVGLLRSN-----PHVHFVEED
Kpol_1032.5        -----------SILGGIEEAFNVANLFHGYIGHF-NEQLVQFIRLS-----PIVDFVEQD
NDAI0K02880        ------EEEESFRNGGIISSFNINNILSGYSGYF-TQEVIDLIRLN-----PLVKYVERD
TBLA0A07300        ----------LDLQQPIIDSFNINSLLQGYIGYF-TDDVIDFIRLN-----PLVQFVEQD
NCAS0F00220        -------EDESINQGGILTTFNISNLLNGYVGYF-TDEVLELIRMN-----PLVEYVEKD
CAGL0B03619g       ---------EGLPRGGIKDLFNINDLFQGLIGYF-PEPVVKLLEKS-----DIVEFVERD
Suva_5.7           ------AALSSSEAGGIQDSFNIDSLFSGYIGYF-TQEIVDLIRQN-----PLVDFVEKD
YEL060C            ------TSLSTSEAGGIQDSFNIDNLFSGYIGYF-TQEIVDLIRQN-----PLVDFVERD
Skud_5.29          ------SSLSTSETGGIQDSFNIDNMFSGYIGYF-TQEIIDLIRQN-----PLVDFVERD
Smik_5.27          ------TYLSTSEAGGIQDSFNIDNIFSGYIGYF-TQEIIDLIRQN-----PLVDFVERD
KLLA0D00979g       -EHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYF-TKEVIDFIRRS-----PLVEFVEED
TDEL0G04550        -----------RTTGGIQDSFDVAGLLNGYVGYF-TDAVVELIRKS-----PMVDFVEMD
SAKL0E01012g       -SADEYGIAAKSSEGGIQESFDIANMLNGYIGYF-TDEVVDFIRMN-----QWVEFIEKD
KLTH0C11396g       ELDYQRSFSAQTREGGIQDSFDVSGLLTGYIGYF-TDEIVDFIRMN-----PLVDFVEQD
Kwal_56.22387      ---EEMGIMATSREGGILDSFDVNGMLRGYIGYF-TQEIVDFIRMN-----PLVAFVEQD
KAFR0B06550        --------------KSNLNIFKIGTTLSGYILRG-PIETLQLLRQD-----PIVQLIEPD
NDAI0I02280        --------------SKVLSRFQISNDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERD
NCAS0D02630        ----------------ILHSFQLAHDLQGYTSRL-PEQLIRSLATD-----PIIQSIEQD
                                       * :     *             :  .       :  :* :

CAGL0E02651g       SIVRINNYKMQEHVPWGLGRISQREKLPILGKRFYHY-DDRGGKDTVTFVIDTGIYVDHE
Smik_15.172        STVRLSNTSMQKDAPWGLHRISHREKAKYGQDLEYLY-EDAAGRGVTSYVLDTGIDTEHE
YOR003W            TTVKISNSSLQEEAPWGLHRVSHREKPKYGQDLEYLY-EDAAGKGVTSYVLDTGIDTEHE
Skud_15.164        STVRISNSSRQEDAPWGLHRISHRERAKYGQDLEYLY-EDAAGTGVTSYVLDTGIDTEHE
Suva_15.178        STVKVTNSTFQEEAPWGLHRISHREKAKYGQDLEYLY-EDAAGRGVTSYVLDTGIDINHE
Kpol_1045.75       SMVHTTEATTQYNAPWGLARISHRSRLNLSTFNKYLY-DDLGGKGVKAYVIDTGINITNV
KAFR0L00360        TMVHTTDFNTQNNAPWGLARISHRESLNLANFNKYLY-DDDAGKNVDAYVIDTGVDVNHV
TPHA0M00230        SVVHSLD-ETQNNAPWGLARISHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHL
KNAG0E00920        SEVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKYLY-DDAAGEGVDSYIIDTGINVKHK
ZYRO0C07942g       SVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLY-DEQGGSGVTSYVIDTGVNVHHN
Ecym_3018          SIVHASDFETQTGAPWGLARVSHRERLNLGSFNKYLY-DDNAGKGVTAYVIDTGINIDHV
ACR012C            SMVFASDFTTQNGAPWGLARVSHREKLNSGSFNKYLY-DDNSGEGVTSYVIDTGINIDHV
Kpol_1032.5        SIVHANEVDTQNNAPWGLARISHRDGLNLGSYNKYLY-DDVAGEGVTAYVIDTGINIKHK
NDAI0K02880        SIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLY-DDDAGKGVTCFVIDTGINVNHV
TBLA0A07300        STVNINEFDTQNGAPWGLARISHRERLNLGSFNKYLF-DDKAGEGVTAYVIDTGVNVEHN
NCAS0F00220        SLVQATEFDNQNNAPWGLARISHRERLNLGSFNKYLY-DDDAGKGVTCYVIDTGINTEHN
CAGL0B03619g       SVVHASNFDTQNNAPWGLARISHRDRLNLGNFNKYLY-DNAGGEGVTAYVIDTGINVKHV
Suva_5.7           SVVEATDFDTQNSAPWGLARVSHRERLNLGSFNKYLY-DDDAGRGVTSYVIDTGVNVNHK
YEL060C            SIVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLY-DDDAGRGVTSYVIDTGVNINHK
Skud_5.29          SVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLY-DDDAGRGVTSYVIDTGVNVNHK
Smik_5.27          SVVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLY-DDDAGRGVTSYVIDTGVNINHK
KLLA0D00979g       SMVFSNSFNTQNSAPWGLARISHREKLNLGSFNKYLY-DDDAGKGVTAYVVDTGVNVNHK
TDEL0G04550        SPVHASEFDTQNGAPWGLSRISHRERLNLGSFNKYLF-DDEAGKGVTSYVIDTGINVKHQ
SAKL0E01012g       SLVFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLY-DDDAGKGVTSYVIDTGINVNHK
KLTH0C11396g       SVVFAQEFGTQNGAPWGLSRISHREKLNLGSFNKYLY-DDDAGKGVTSYVIDTGVNVDHK
Kwal_56.22387      SMVYANEFDTQNGAPWGLSRISHREKLNLGSFNKYLY-DDAAGKGVTSYVIDTGINIDHK
KAFR0B06550        SKVHALKLKIQEDTPWGLSRISQRPRVRIGQDQLYYY-DDATSGNVTAYVLDTGIMISHE
NDAI0I02280        SYVHMNKFTTQIDSSWGLSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHI
NCAS0D02630        SYVHALGRQKQIDSPWGLARISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHN
                   : *       :   .*** *:*:*          * : ..  . ..  :::***:   : 

CAGL0E02651g       DFEGRASWGKTIVENDNDY-DLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSM
Smik_15.172        DFEGRAVWGAVIPGNDEAS-DLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTV
YOR003W            DFEGRAEWGAVIPANDEAS-DLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTV
Skud_15.164        DFEGRAKWGAVIPENDEAS-DLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTV
Suva_15.178        DFEGRAVWGAVIPDNDEAS-DLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTV
Kpol_1045.75       DFGGRAYWGKTIPAGEANV-DGNGHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSM
KAFR0L00360        EFHSRAHWGKTIPLNDQDI-DGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSM
TPHA0M00230        EFGERAKWGKTIPINDYDI-DGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTM
KNAG0E00920        EFEGRAQWGKTIPDNDFDE-DGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSM
ZYRO0C07942g       QFGGRAKWGKTIPAGDLDE-DGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSM
Ecym_3018          EFEGRAQWGKTIPSNDADY-DGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTM
ACR012C            DFEDRALWGKTIPNNDADY-DGNGHGTHCAGTIASKTYGVAKKANVVAVKVLRSNGTGSM
Kpol_1032.5        EFGGRAVWGKTIPENDQDV-DGNGHGTHCAGTIASKNYGVAKNAEVVAVKVLRSDGSGTM
NDAI0K02880        DFGKRAIWGKTIPSNDQDI-DGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSM
TBLA0A07300        DFEGRASWGKTIPNNDEDL-DGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSM
NCAS0F00220        DFNKRAVWGKTIPLNDKDI-DGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSM
CAGL0B03619g       EFDGRAQWGKTIPLNDLDI-DGNGHGTHCAGTIASKHYGIAKKANVVAVKVLKSDGSGTM
Suva_5.7           DFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTM
YEL060C            DFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTM
Skud_5.29          DFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTM
Smik_5.27          DFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTM
KLLA0D00979g       DFDGRAVWGKTIPKDDPDV-DGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTM
TDEL0G04550        DFEGRAHWGKTIPTNDEDL-DGNGHGTHCAGTIASKHYGVAKGADVVAVKVLRSNGSGSM
SAKL0E01012g       DFNGRAVWGKTVPQNDEDA-DGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTM
KLTH0C11396g       DFEGRASWGKTIPTNDLDQ-DGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSM
Kwal_56.22387      DFEGRAAWGKTVPTNDLDQ-DGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSM
KAFR0B06550        QFNGRARWGKTIVPNDVDE-DNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDM
NDAI0I02280        EFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSM
NCAS0D02630        EFQGRAKWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEM
                   :*  ** **  .   :    * .***** ** *.*  :*::*   : *:***   * * :

CAGL0E02651g       SDVIRGVEYTVEAYNDLKKTKS------N-----LKGAAGNMSLGAWKSYALNRAMDAAA
Smik_15.172        SDVIKGIEYVAREHIESSRKKS------KE----FKGSTANLSLGSSKSLAMEMAVDAAV
YOR003W            SDVIKGIEYVTKEHIESSKKKN------KE----FKGSTANLSLGSSKSLAMEMAVNAAV
Skud_15.164        SDVIKGIEYVAKNHIASSKKRG------SK----FKGSTANLSLGSSKSPAMEMAVNAAV
Suva_15.178        SDVIKGIEYVVKDHIDSSKKGG------PK----FKGSTANLSLGSSKSPAMEMAVNAAV
Kpol_1045.75       SDVLKGVEYVVGAHQRDVGTAG------------FKGSVANMSLGGGKSRSLDLAVNAAV
KAFR0L00360        SDVVKGVEFAVSSHLERMKNEK------N-----LKGSVANMSLGGGKSPALDLAVNAAV
TPHA0M00230        SDVLKGVEWVALEHTKHLEESR------KDKNSNYKGATANMSLGGGKSPALDQAVNAAV
KNAG0E00920        SDVIMGVEFAAKQHASKAKSND------KK----FKGSTANMSLGGGKSPSLDRVVDAAV
ZYRO0C07942g       SDVLKGVEWAAQDHQNAVKQKK------PG----FKGSTANMSLGGGKSPSLDQAVNAAV
Ecym_3018          SDVLRGVEYVVAEHRKASGDPN------------FKGSTANMSLGGGKSAALELAVDAAV
ACR012C            SDVLRGVEYAVKAHRKAAEKAD------KG----FKGSTANMSLGGGRSQALDLAVDAAV
Kpol_1032.5        SDVLKGVEYAAFSHQKALREKK------KG----FKGSTANMSLGGGKSRSLDLAVDAAV
NDAI0K02880        SDVIKGVEFAAETHLNNEKNKK------D-----YKGSTANMSLGGGKSPTLDLAVNAAV
TBLA0A07300        SDVLKGVEYATASHLADVKNKK------SG----FKGSTANMSLGGGKSPSLDLAVNAAV
NCAS0F00220        SDVIKGVEFAAESHIKAAKEKK------KG----FKGSTANMSLGGGKSPTLDLAVNAAV
CAGL0B03619g       SDVIKGVEYAAQAHLKESKNNK------K-----FKGSTANMSLGGGKSPALDMAVNAAV
Suva_5.7           SDVLKGVEYAAKAHQKQAEEKK------KG----FKGSTANMSLGGGKSPALDLAVNAAV
YEL060C            SDVVKGVEYAAKAHQKEAQEKK------KG----FKGSTANMSLGGGKSPALDLAVNAAV
Skud_5.29          SDVVKGVEYAARAHQKQAQEKK------KG----FKGSTANMSLGGGKSPALDLAVNAAV
Smik_5.27          SDVVKGVEYAAKAHQKQAQEKK------KG----FKGSTANMSLGGGKSPALDLAVNAAV
KLLA0D00979g       SDVVKGVEYVAEAHKKAVEEQK------KG----FKGSTANMSLGGGKSPALDLAVNAAV
TDEL0G04550        SDVIKGVEFAAQSHQKAVKDKK------KG----FKGSTANMSLGGGKSPALDLAVNAAV
SAKL0E01012g       SDVVKGVEFAAQSHQEASKKNK------KG----FKGSTANMSLGGGKSPALDLAVNAAV
KLTH0C11396g       SDVVKGVEFAAKSHQDAVKENK------KG----FKGSTANMSLGGGKSPALDMAVNAAV
Kwal_56.22387      SDVVKGVEFAAKSHQDAVKKNK------KG----FKGSTANMSLGGGKSPALDMAVNAAV
KAFR0B06550        SDVLKGIEFVVDDHSKNKNYS--------------KGSVVNLSLGASKSPALVLAIDAAI
NDAI0I02280        SDVILGLEFVANSHTNKTNNISSSSSVHSE----FKGSVVNLSLGAPKSPSLDIALESAK
NCAS0D02630        SAVIRGIEYVTQQHEQDMKKQD-----QTG----FKGSVINLSLGAGKSPALLRVIEAAV
                   * *: *:*:..  :                     **:. *:***. .* ::  .:::* 

CAGL0E02651g       AAGISFAVAAGNESDDACNSSPASAWSPITVGGSTLSDDVAFFSNYGRCVDIFAPGVNIM
Smik_15.172        DSGVHFAIAAGNENEDACLSSPAGAQKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIM
YOR003W            DSGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIM
Skud_15.164        DCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIM
Suva_15.178        ESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSDDRAFFSDWGTCVDVFAPGVNIL
Kpol_1045.75       GAGVHFAVAAGNENQDACNTSPAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNIL
KAFR0L00360        KAGIHFAVAAGNENQNACNSSPASAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNIL
TPHA0M00230        KAGVHFAVAAGNENQDACNSSPAAAENAITVGASTLSDDRAYFSNYGKCVDIFAPGLNIL
KNAG0E00920        KLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDDRAYFSNWGSCVDIFAPGLNIL
ZYRO0C07942g       AAGLNFAVAAGNEDQDACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNIL
Ecym_3018          AAGIHFAVAAGNENQDACNTSPASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNIL
ACR012C            DAGIHFAVAAGNENQDACNTSPAASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNIL
Kpol_1032.5        KSGIHFAVAAGNENQDACNSSPAASENAITVGASTLSDDRAYFSNWGKCVDVFAPGLNIL
NDAI0K02880        EAGIHFSVAAGNENQDACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNIL
TBLA0A07300        KAGIHFAVAAGNENQDACNTSPASAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNIL
NCAS0F00220        DAGIHFAVAAGNENQDACNTSPASAERAITVGASTLSDDRAYFSNWGKCVDIFAPGLNIL
CAGL0B03619g       SAGIHFAVAAGNENQDACNTSPASAEKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNIL
Suva_5.7           EAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNIL
YEL060C            EVGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNIL
Skud_5.29          EAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNIL
Smik_5.27          EAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNIL
KLLA0D00979g       KAGVHFAVAAGNENQDACNTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFGPGLNIL
TDEL0G04550        KAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNIL
SAKL0E01012g       KAGIHFAVAAGNENQDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVL
KLTH0C11396g       KAGIHFAVAAGNENQDACNSSPASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVL
Kwal_56.22387      KAGIHFAVAAGNENQDACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVL
KAFR0B06550        SENIHFAVAAGNENMDACYTSPADARRAITVGASIFSDERAFFSNWGECVDVFAPGMNVM
NDAI0I02280        KIGIHITVAAGNEDEDACMTSPADSPAVITVGASSFSDDRAFFSNWGPCVDVFAPGINIK
NCAS0D02630        KLGVHFAVAAGNEDDDACSTSPADSPHALTVGASSFSDDRVFFSNWGPCVDVFAPGINIM
                     .: :::*****. :** :*** :   :**..* ::*. .:**::* **.:*.**:*: 

CAGL0E02651g       STYIG-SKNATESLSGTSMSSPHVAGVLAYYLSLQPDHKSQFYHEHSA--ISPKILKKKV
Smik_15.172        STYIG-SRNATLSLSGTSMAAPHVAGMLSYFLSLQPAPDSEYFDNA----LSPQELKEKV
YOR003W            STYIG-SRNATLSLSGTSMASPHVAGILSYFLSLQPAPDSEFFNDA----PSPQELKEKV
Skud_15.164        STYIG-SRNATLSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDT----VSPQQLKEKI
Suva_15.178        STYIG-SRNASLSLSGTSMAAPHVAGILSYFLSLQPSSDSEFFDST----VSPQQLKEKI
Kpol_1045.75       STYIG-SPDATATLSGTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKI
KAFR0L00360        STYIGANDDVTATLSGTSMASPHVAGLLAYYLSLQPEKSSEFSTRA----ISTSQLKKKL
TPHA0M00230        STYIG-TNDATATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNSE--LTPLQMKKKI
KNAG0E00920        STYTG-SDDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQ---ITPEQLKKKL
ZYRO0C07942g       STYIG-SDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSS---ISPDQLKKKL
Ecym_3018          STYIG-SDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSS---ISPEALKKKI
ACR012C            STYIG-SDTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEFRNKQT---ISPEVLKKKV
Kpol_1032.5        STYIG-SDEATATLSGTSMASPHVAGLLSYFLSMQPDADSEFFSSGSNS-ISPAQLKKKL
NDAI0K02880        STYVGDGNDNTATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKL
TBLA0A07300        STYIG-SDDATATLSGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGG-ITPAQLKKRL
NCAS0F00220        STYIG-DDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTE---LTPAQMKKKL
CAGL0B03619g       STYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQPDSDSEFYDASKHG-VTPAQLKKKL
Suva_5.7           STYIG-SDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDS-LTPQQLKKKL
YEL060C            STYIG-SDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDS-LTPQQLKKKL
Skud_5.29          STYIG-SDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDS-LTPQQLKNKL
Smik_5.27          STYIG-SDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDS-LTPQQLKKKL
KLLA0D00979g       STYIG-SDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGG--ITPSQLKKKL
TDEL0G04550        STYIG-SDDATATLSGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQG-VTPEQLKKKL
SAKL0E01012g       STYIG-SETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASG---ITPAQLKKKL
KLTH0C11396g       STYIG-SDTATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGG--ITPSQLKKKL
Kwal_56.22387      STYIG-SETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGG--ITPSQLKKKL
KAFR0B06550        STYIG-SDNATLSLSGTSAAAPYTAGLIAYYLSLQPDKDSGYFTGE----MTPSKLKEKI
NDAI0I02280        STYIGPNNNETLSLSGSSMSSPFVSGLTAYYLSLQPDVSSQFHDSL----MTPDQLKRKI
NCAS0D02630        STYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQPDTKSQFYTGITS--PTPYQLKYKI
                   *** *       :***:* ::*.  *: :* **:**   * :         :.  :* .:

CAGL0E02651g       LNYATNGTLSYLPA-ETVNLLVYNGGGKNLSKFWGT------------------------
Smik_15.172        LKFSTHGVLGDIGD-NTPNRLIYNGGGKILDDLW--------------------------
YOR003W            LKFSTQGVLGDIGD-DTPNKLIYNGGGKKLDGFW--------------------------
Skud_15.164        LKFSTRGVLGDVNE-ETPNRLVYNGGGKKLDEFWRF------------------------
Suva_15.178        INFSTQGVLGDVGE-DTPNRLIYNGGGRKLDNFW--------------------------
Kpol_1045.75       VAFGTKNALRDLPA-NTPNVIAYNGAGKSLEDFWNAN-----------------------
KAFR0L00360        IEYATKDVLEDLPE-GTPNVLIYNGGGQDLSDFWNLQNSKIPGS----------------
TPHA0M00230        IDYATKNALADLPA-DTPNKLIYNG-GFNSTDFWASAAAPQSHK----------------
KNAG0E00920        LDYSTKGVLFDLPE-DTPNALIYNGGGADLSDFWGDKGKKSHKP----------------
ZYRO0C07942g       LAFSTKDVLSDIPS-GTPNLLIYNGGGGDLSGFWGSKEVAQELE----------------
Ecym_3018          VAYGSKNLLNNVPA-RTANNLIFNGGGGSLDSFWNSKCDGCEQEK---------------
ACR012C            IDFGTKDALSSLPA-RTANVLIYNGGGADLSDFWGNKPKKVSGPKF--------------
Kpol_1032.5        IAYSTKNLFQDLPE-KTPNLLVYN-AGHNISDFWKPKSESSAEP----------------
NDAI0K02880        IAYSTSDILYDLPD-GTPNKLIYNGAGGDISDLWNGKVQEQAHE----------------
TBLA0A07300        ISYGTKDILLDIPE-LTPNVLVFNGAGQDLSDFWNIS-----------------------
NCAS0F00220        INYSSKDVLFDLPE-GTPNKLIFNGAGGNLDDLWNKKSQEEDIKVKGGCDHKKHKGKKHG
CAGL0B03619g       IAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWNSTSADEQSA----------------
Suva_5.7           IHYSTKDILFDIPD-DTPNALIYNGGGQDLSAFWNDTKKSHSSS----------------
YEL060C            IHYSTKDILFDIPE-DTPNVLIYNGGGQDLSAFWNDTKKSHSSG----------------
Skud_5.29          IHYSTKDILFDVPE-DTPNALIYNGGGQDLSAFWNDTKKSHSSR----------------
Smik_5.27          IHYSTKDILFDIPE-DTPNFLIYNGGGQDLSAFWNDTKKSHPSG----------------
KLLA0D00979g       IDFSTKNVLSDLPE-DTVNYLIYNGGGQDLDDLWGKDYSIGKEP----------------
TDEL0G04550        IAYSTKDILYDLPE-DTPNALIYNGGGHGLKGFWDGHDKQEANT----------------
SAKL0E01012g       IAYSTKDVLYELPE-DTPNYLIYNGGGQDLSDFWGKSEEQVKEE----------------
KLTH0C11396g       IAYSTKNVLGDIPD-DTVNYLIFNGGGEGLDDFWGKESVVDEVE----------------
Kwal_56.22387      IAYSTKNALGDLPE-DTVNYLIYNGGGQDLDDFWVKDLEEKVAD----------------
KAFR0B06550        VAFGSKDVLYELPE-NTPNIVIYNGAGRNLSHFWKDY-----------------------
NDAI0I02280        IDFSTNGMLKELPL-DTANKLVYNGGGKDLSGFWNATRKEN-------------------
NCAS0D02630        ISFSTEGVLHEIPE-GTPNRIVYNGGGHSLKDFWNN------------------------
                   : :.: . :  :    : * : :*  *     :*                          

CAGL0E02651g       ------------------------------------------------------------
Smik_15.172        ------------------------------------------------------------
YOR003W            ------------------------------------------------------------
Skud_15.164        ------------------------------------------------------------
Suva_15.178        ------------------------------------------------------------
Kpol_1045.75       ------------------------------------------------------------
KAFR0L00360        ------------------------------------------------------------
TPHA0M00230        ------------------------------------------------------------
KNAG0E00920        ------------------------------------------------------------
ZYRO0C07942g       ------------------------------------------------------------
Ecym_3018          ------------------------------------------------------------
ACR012C            ------------------------------------------------------------
Kpol_1032.5        ------------------------------------------------------------
NDAI0K02880        ------------------------------------------------------------
TBLA0A07300        ------------------------------------------------------------
NCAS0F00220        SKDHKKHDGPKDHKKHDGPHGPHDPERHHRPEDHDGPRGPHGPHDPERHHRPEDHDGPKD
CAGL0B03619g       ------------------------------------------------------------
Suva_5.7           ------------------------------------------------------------
YEL060C            ------------------------------------------------------------
Skud_5.29          ------------------------------------------------------------
Smik_5.27          ------------------------------------------------------------
KLLA0D00979g       ------------------------------------------------------------
TDEL0G04550        ------------------------------------------------------------
SAKL0E01012g       ------------------------------------------------------------
KLTH0C11396g       ------------------------------------------------------------
Kwal_56.22387      ------------------------------------------------------------
KAFR0B06550        ------------------------------------------------------------
NDAI0I02280        ------------------------------------------------------------
NCAS0D02630        ------------------------------------------------------------
                                                                               

CAGL0E02651g       ------------------------------------------------------------
Smik_15.172        ------------------------------------------------------------
YOR003W            ------------------------------------------------------------
Skud_15.164        ------------------------------------------------------------
Suva_15.178        ------------------------------------------------------------
Kpol_1045.75       ------------------------------------------------------------
KAFR0L00360        ------------------------------------------------------------
TPHA0M00230        ------------------------------------------------------------
KNAG0E00920        ------------------------------------------------------------
ZYRO0C07942g       ------------------------------------------------------------
Ecym_3018          ----------------------------------------------------------VS
ACR012C            ----------------------------------------------------------TY
Kpol_1032.5        ------------------------------------------------------------
NDAI0K02880        ------------------------------------------------------------
TBLA0A07300        ------------------------------------------------------------
NCAS0F00220        HKKHDGPHGPHDPERHHRPEDHAGPHHPDDHGGHKKHDGPHHPEDHKDHKKHDGEEDHKD
CAGL0B03619g       ----------------------------------------------------------EH
Suva_5.7           ------------------------------------------------------------
YEL060C            ------------------------------------------------------------
Skud_5.29          ------------------------------------------------------------
Smik_5.27          ------------------------------------------------------------
KLLA0D00979g       ------------------------------------------------------------
TDEL0G04550        ------------------------------------------------------------
SAKL0E01012g       ------------------------------------------------------------
KLTH0C11396g       ------------------------------------------------------------
Kwal_56.22387      ------------------------------------------------------------
KAFR0B06550        ------------------------------------------------------------
NDAI0I02280        ------------------------------------------------------------
NCAS0D02630        ------------------------------------------------------------
                                                                               

CAGL0E02651g       ------------------------------------------
Smik_15.172        ------------------------------------------
YOR003W            ------------------------------------------
Skud_15.164        ------------------------------------------
Suva_15.178        ------------------------------------------
Kpol_1045.75       ------------DYVKNYQSL-----VITEQLQFILNKMNIF
KAFR0L00360        ------------NYI---------GYNYFSKLKTLFDDLNFY
TPHA0M00230        ---VKTNRYSLGSFLDSIQDS---NNHWFN-----FDNMNIF
KNAG0E00920        ------------LFAHEYDNVWASSDAMFEQVRAMFGKLNIF
ZYRO0C07942g       --FNEKVDLELHDLVDELGSK---TDAVFGQIRGLMDRLDII
Ecym_3018          SSHGKADDFESESLMDCLHST---SHSLFGEIRNFLDRLDLI
ACR012C            ADDEEAMGSDLDRLIHELESS---TDAMFSGFRTILDRMNII
Kpol_1032.5        --NERAKEFELEDLVDSAQWI---ADTWLNGIQQVFERMDLF
NDAI0K02880        -EPAHEDKINFENLVDS-DSMSGKTDLFFDQIRNVFEKMNII
TBLA0A07300        ----KPADLESNEVYKNLDLV---GDVLYDQFTGIFKKMNLL
NCAS0F00220        NKKHHQEQISPADLAKSLGTS---SDSVFQQIRDMFDRMDIL
CAGL0B03619g       PEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII
Suva_5.7           ---GFKQELNLDEFIGSK------TDLIFEQVRDVLDKLNII
YEL060C            ----FKQELNMDEFIGSK------TDLIFDQVRDILDKLNII
Skud_5.29          ----FKQELNMDEFI---GSK---TDLIFEQVRDVLDKLNII
Smik_5.27          ----SKHELNMDEFIGSK------TDLLFEQVRDVLDKLNII
KLLA0D00979g       ---SANPEFSLESLINSLDSK---TDAIFDDVRQLLDQFNII
TDEL0G04550        ----RFQDTDLQELSDNLGAK---TDALFDQVRDVLDRLNII
SAKL0E01012g       GSIQDFKDFKLSELIESFDTK---TDLLFEEVRSVFDKLNII
KLTH0C11396g       ----DTISSEIESFIDALEEK---TDVLYEEIREVFDHMNII
Kwal_56.22387      --AKDNTASEFESIIDALEEK---TDGLYEEIREIFEGLNII
KAFR0B06550        ------------------------------------------
NDAI0I02280        ------------------------------------------
NCAS0D02630        ------------------------------------------
                                                             

FASTA FORMAT for MUSCLE Version 3.6

>CAGL0E02651g
-------------------------------MFSFYLITSVYYFWIFTSVDAATIPVDLS
HRESASHDYTLIN-----------------------------------------------
------------------------------------------------------------
---------RLLNLWRGKGIE---------------------------------------
-----------------------------------------YNFNTGSKIYFDSAKN---
--DMIIPNRYIVLFKDFVTDKEIQSHLSAIEEINSSSI--FLQDSDFGKATQY-------
-------NDISTRGIGLQHEFSIGRSMTGYIGYF-TETTAKFIANS-----PLVELVEHD
SIVRINNYKMQEHVPWGLGRISQREKLPILGKRFYHY-DDRGGKDTVTFVIDTGIYVDHE
DFEGRASWGKTIVENDNDY-DLNGHGTHCAGTIASKHYGIAKQAEVIAVKVLRSDGSGSM
SDVIRGVEYTVEAYNDLKKTKS------N-----LKGAAGNMSLGAWKSYALNRAMDAAA
AAGISFAVAAGNESDDACNSSPASAWSPITVGGSTLSDDVAFFSNYGRCVDIFAPGVNIM
STYIG-SKNATESLSGTSMSSPHVAGVLAYYLSLQPDHKSQFYHEHSA--ISPKILKKKV
LNYATNGTLSYLPA-ETVNLLVYNGGGKNLSKFWGT------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------
>Smik_15.172
----------------------------------MKF-STILPILW-ASCNLCMIIPEF-
-DEIVRFTQITDD-----------------------------------------------
------------------------------------------------------------
---------SRNTKSLKNLRQ---------------------------------------
-----------------------------------------QYSGGFLMGGLDNTHK---
--TELIPYRYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDVFLEVVSS-------
------SIAPDLQLGGIDSSFDINGLFRGYAGYF-TDEILNLVSQD-----PLIKFIEQE
STVRLSNTSMQKDAPWGLHRISHREKAKYGQDLEYLY-EDAAGRGVTSYVLDTGIDTEHE
DFEGRAVWGAVIPGNDEAS-DLNGHGTHCAGIIGSKHYGVAKNTKLVAVKVLRSNGEGTV
SDVIKGIEYVAREHIESSRKKS------KE----FKGSTANLSLGSSKSLAMEMAVDAAV
DSGVHFAIAAGNENEDACLSSPAGAQKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIM
STYIG-SRNATLSLSGTSMAAPHVAGMLSYFLSLQPAPDSEYFDNA----LSPQELKEKV
LKFSTHGVLGDIGD-NTPNRLIYNGGGKILDDLW--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------
>YOR003W
----------------------------------MKF-STILPILW-ANCCLCMIIPDF-
-DGIVRFIENIDG-----------------------------------------------
------------------------------------------------------------
---------TRSVRAGEGLGQ---------------------------------------
-----------------------------------------HDPGNFHTEHQHVAHK---
--TEFLPYRYVIVFNEDISLQQIQSHMQVVQKDHSTSVGKLTENDAFWRVISS-------
------SVSSKSQFGGIDNFFDINGLFRGYTGYF-TDEIIKIISQD-----PIIKFVEQE
TTVKISNSSLQEEAPWGLHRVSHREKPKYGQDLEYLY-EDAAGKGVTSYVLDTGIDTEHE
DFEGRAEWGAVIPANDEAS-DLNGHGTHCAGIIGSKHFGVAKNTKIVAVKVLRSNGEGTV
SDVIKGIEYVTKEHIESSKKKN------KE----FKGSTANLSLGSSKSLAMEMAVNAAV
DSGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIM
STYIG-SRNATLSLSGTSMASPHVAGILSYFLSLQPAPDSEFFNDA----PSPQELKEKV
LKFSTQGVLGDIGD-DTPNKLIYNGGGKKLDGFW--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------
>Skud_15.164
----------------------------------MNMKLFNILLILCAGGTLCMIIPELN
EIAYYSETFENFR-----------------------------------------------
------------------------------------------------------------
-----------NAKAQDGLGQ---------------------------------------
-----------------------------------------QNIENLHLGRQKVLRG---
--SKSLPYRYIIVFNEDITNRLIESHTQMIQKAQKVSVSKITEDDSFLRTVSA-------
------SASPNPQFGGIDISFDINGLFRGYTGYF-TDEVIEIVFQD-----PLVKFIEHE
STVRISNSSRQEDAPWGLHRISHRERAKYGQDLEYLY-EDAAGTGVTSYVLDTGIDTEHE
DFEGRAKWGAVIPENDEAS-DLNGHGTHCAGIIGSRHFGVAKNTNILAVKVLRSNGEGTV
SDVIKGIEYVAKNHIASSKKRG------SK----FKGSTANLSLGSSKSPAMEMAVNAAV
DCGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSDDRAFFSNWGTCVDVFAPGINIM
STYIG-SRNATLSLSGTSMAAPHVAGILSYLLSLQPAQDSEFFYDT----VSPQQLKEKI
LKFSTRGVLGDVNE-ETPNRLVYNGGGKKLDEFWRF------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------
>Suva_15.178
----------------------------------MKLLTVLLALC--AGCGVCMIIPGLD
EIVYLTESIEDFR-----------------------------------------------
------------------------------------------------------------
-----------NAKGQEGLGQ---------------------------------------
-----------------------------------------QETGNFHLQEPKVVYK---
--AESLPYRYIIAFHEDSSVRSIESHKRMIQEVQNESVSKLAKDDAFFVSTSA-------
--------PSDLQFGGIDSFFDINGLFRGYTGYF-TEEVIKRVLQD-----PIIKFIEQE
STVKVTNSTFQEEAPWGLHRISHREKAKYGQDLEYLY-EDAAGRGVTSYVLDTGIDINHE
DFEGRAVWGAVIPDNDEAS-DLNGHGTHCAGIIGSRHFGVTKNTNLVAVKVLRSNGEGTV
SDVIKGIEYVVKDHIDSSKKGG------PK----FKGSTANLSLGSSKSPAMEMAVNAAV
ESGVHFAIAAGNEDEDACLSSPAGAEKSITVGASTFSDDRAFFSDWGTCVDVFAPGVNIL
STYIG-SRNASLSLSGTSMAAPHVAGILSYFLSLQPSSDSEFFDST----VSPQQLKEKI
INFSTQGVLGDVGE-DTPNRLIYNGGGRKLDNFW--------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------
>Kpol_1045.75
--------------------------------------MLFLVFLTLLNFCHALVLPEE-
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------VRPASLITPN----------
--SEVIPYNYIVVFNEGVTQNEISLHIETMSQLQLQSVTDLPYDHEFFTISTS-------
-----SDVNSNGLLGGVRDMFKIGNDLHGYTGMF-TDEVVEFLRLS-----PLVKFIERD
SMVHTTEATTQYNAPWGLARISHRSRLNLSTFNKYLY-DDLGGKGVKAYVIDTGINITNV
DFGGRAYWGKTIPAGEANV-DGNGHGTHVAGTIASIHYGVAKQVKVYAVKVLRSNGAGSM
SDVLKGVEYVVGAHQRDVGTAG------------FKGSVANMSLGGGKSRSLDLAVNAAV
GAGVHFAVAAGNENQDACNTSPAAAERAITVGASTLSDSRAYFSNWGQCVSIFAPGLNIL
STYIG-SPDATATLSGTSMASPHIAGLVAYFLSLQPAVKSQFYSQGQATAITPDQLKKKI
VAFGTKNALRDLPA-NTPNVIAYNGAGKSLEDFWNAN-----------------------
------------------------------------------------------------
------------------------------------------------------------
------------DYVKNYQSL-----VITEQLQFILNKMNIF
>KAFR0L00360
----------------------------------MQLLIHLLLVC--STLVNALVIPSLK
DSIDKFSDDIHGL-----------------------------------------------
------------------------------------------------------------
---------LDSAKFS--------------------------------------------
-----------------------------------------SLAPVHN------ADA---
--ENIIPHRYIIVFKDGVSKEQIQFHKELITTLHLQQSSAFSNDFTEYLQTDI-------
----NVPESMRQSLGGIVSDFDISSLLSGYIAYL-SDELLHFIRLN-----PLIAFIEHD
TMVHTTDFNTQNNAPWGLARISHRESLNLANFNKYLY-DDDAGKNVDAYVIDTGVDVNHV
EFHSRAHWGKTIPLNDQDI-DGNGHGTHVAGTIGSQHYGVAKSVNIIAVKVLRSNGSGSM
SDVVKGVEFAVSSHLERMKNEK------N-----LKGSVANMSLGGGKSPALDLAVNAAV
KAGIHFAVAAGNENQNACNSSPASAEQAVTVGASTISDERAYFSNWGECVDIFAPGLNIL
STYIGANDDVTATLSGTSMASPHVAGLLAYYLSLQPEKSSEFSTRA----ISTSQLKKKL
IEYATKDVLEDLPE-GTPNVLIYNGGGQDLSDFWNLQNSKIPGS----------------
------------------------------------------------------------
------------------------------------------------------------
------------NYI---------GYNYFSKLKTLFDDLNFY
>TPHA0M00230
MLGGSVHSSARVSLSWPRYNYTTTIHNYHTQLYNMKLQNTLVSAVIAASVAEALVIPALD
QGRGRGHALDHGP-------------------------------NNNNNVPAFMMRAAAA
PASA--------------------------------------------------------
---------MEMVKDVTDQIL---------------------------------------
------------------AYYQHASPASRGL----------ELAALHDNGVGTADHD---
--------RYIIVFKKGVFKEQVDQHLKMMSAL----FRRLSEEQRPAAAPGA-------
-------SALRDGFDRVMDTFEVAGAFSGYIATVASPKIVDFIRLN-----PLVDYVEKD
SVVHSLD-ETQNNAPWGLARISHREGLNLGNFNKYLYASNSAGKGVTAYVVDTGISVSHL
EFGERAKWGKTIPINDYDI-DGNGHGTHCAGTIGSEHYGVAKGANLVAVKVLRSDGSGTM
SDVLKGVEWVALEHTKHLEESR------KDKNSNYKGATANMSLGGGKSPALDQAVNAAV
KAGVHFAVAAGNENQDACNSSPAAAENAITVGASTLSDDRAYFSNYGKCVDIFAPGLNIL
STYIG-TNDATATLSGTSMASPHVAGLLTYLLSLQPDKGSEFYVPNSE--LTPLQMKKKI
IDYATKNALADLPA-DTPNKLIYNG-GFNSTDFWASAAAPQSHK----------------
------------------------------------------------------------
------------------------------------------------------------
---VKTNRYSLGSFLDSIQDS---NNHWFN-----FDNMNIF
>KNAG0E00920
----------------------------------MKITQPVLWAVALNRVAEALVLPEIR
DERGVSQGEHGGR---------------------------------RHDVEEHGRRGRPH
HGPKH-------------------------------------------------------
---------EKDEHRPCKHGKEAHDEE---------------------------------
-----------------------------------------ELAPLYTPGSALSASS---
----SRSNKYIILFKEGVTAEQISAHKQLLQQVLLETS----------------------
------DVSAQGIVADVLDSFDLEGVLSGYVAEL-SPMVLELVRRS-----PFVQLVEQD
SEVHTNEFDTQNNAPWGLARISHRDPLSLGSFNKYLY-DDAAGEGVDSYIIDTGINVKHK
EFEGRAQWGKTIPDNDFDE-DGNGHGTHCAGTIASKHYGVAKRANVIAVKVLRSNGSGSM
SDVIMGVEFAAKQHASKAKSND------KK----FKGSTANMSLGGGKSPSLDRVVDAAV
KLGLHFSVAAGNENQDACNTSPAASERAITVGASTLSDDRAYFSNWGSCVDIFAPGLNIL
STYTG-SDDATATLSGTSMASPHVAGLLTYFLSLQPEKSSQFGTSAQ---ITPEQLKKKL
LDYSTKGVLFDLPE-DTPNALIYNGGGADLSDFWGDKGKKSHKP----------------
------------------------------------------------------------
------------------------------------------------------------
------------LFAHEYDNVWASSDAMFEQVRAMFGKLNIF
>ZYRO0C07942g
----------------------------------MKFQKSVIPVATLAGLGSALIIPEL-
----TGSNEYEKR-------------------------------PERTDDVNNGESVVA-
------------------------------------------------------------
---------TSFEKGPSKDEL---------------------------------------
--------------------AVFASKLTQEV--------QDRFAPLVV-----PEDT---
--LGVLENRYIILFKKGVNPQEIGFHRELIEQVHLQEVSQLPEEHSFFEGIRL-------
------DGVYDSPLGGIDHTFDINGMLMGYSGYF-PSKVLDVIRMS-----PLIEMVEQD
SVVYTQKADTENGAPWGLARISHRERLNLGSYNKYLY-DEQGGSGVTSYVIDTGVNVHHN
QFGGRAKWGKTIPAGDLDE-DGNGHGTHCAGTIGSSTYGVAKGADIVAVKVLRSNGSGSM
SDVLKGVEWAAQDHQNAVKQKK------PG----FKGSTANMSLGGGKSPSLDQAVNAAV
AAGLNFAVAAGNEDQDACNTSPASASGPITVGASTLSDDRAYFSNYGKCVDVFAPGLNIL
STYIG-SDSSTATLSGTSMASPHVAGLLAYFLSLQPGSDSEFDAGSS---ISPDQLKKKL
LAFSTKDVLSDIPS-GTPNLLIYNGGGGDLSGFWGSKEVAQELE----------------
------------------------------------------------------------
------------------------------------------------------------
--FNEKVDLELHDLVDELGSK---TDAVFGQIRGLMDRLDII
>Ecym_3018
----------------------------------MKVQSVVLPVAVFSTLGAALILPWM-
DPEIRLDVGLHGR-------------------------------GPHGRVPPPHHHKMGE
HG----------------------------------------------------------
---------RGRGKGHHRGSS---------------------------------------
--------------------VLLVDDEEDKVSPMFEYFEFDSSQDFVDMKLASLSDN---
--SRAIPHRYIVIFKDGVTDYDVGMHQDLVTTAHMETIAQLDPGHSFFDATEG-------
--MHHEGISARSVEGGIEEMFEIAGSLRGYFGYF-TDGMLDLIRES-----GLVKLIEQD
SIVHASDFETQTGAPWGLARVSHRERLNLGSFNKYLY-DDNAGKGVTAYVIDTGINIDHV
EFEGRAQWGKTIPSNDADY-DGNGHGTHCAGTIASKTYGVAKNAKVVAVKVLRTNGTGTM
SDVLRGVEYVVAEHRKASGDPN------------FKGSTANMSLGGGKSAALELAVDAAV
AAGIHFAVAAGNENQDACNTSPASSKKCITVAASTLSDDRAYFSNWGSCVDIFAPGLNIL
STYIG-SDTAVATLSGTSMASPHVAGLLAYFLSLQPDSGSEYYTGSS---ISPEALKKKI
VAYGSKNLLNNVPA-RTANNLIFNGGGGSLDSFWNSKCDGCEQEK---------------
------------------------------------------------------------
----------------------------------------------------------VS
SSHGKADDFESESLMDCLHST---SHSLFGEIRNFLDRLDLI
>ACR012C
----------------------------------MKLQRAVWPAVALTTAQALLILPQA-
-----EDELVVAE--------------------------------------AHRGQLVQW
MA----------------------------------------------------------
---------RENQERKAQGAE---------------------------------------
-----------------------------------------QQSPLFR-----VDDV---
--TRAIPHKYIVVFREGVSDEEAAFHMELVEAAHAESVARLDEQHAFFRSTRG-------
-ENNEFGIAATRAEGGIEGEFALGEQLRGYVGYF-TEDMVGLLRSN-----PHVHFVEED
SMVFASDFTTQNGAPWGLARVSHREKLNSGSFNKYLY-DDNSGEGVTSYVIDTGINIDHV
DFEDRALWGKTIPNNDADY-DGNGHGTHCAGTIASKTYGVAKKANVVAVKVLRSNGTGSM
SDVLRGVEYAVKAHRKAAEKAD------KG----FKGSTANMSLGGGRSQALDLAVDAAV
DAGIHFAVAAGNENQDACNTSPAASQKAITVGASTLADDRAYFSNWGRCVDLFAPGMNIL
STYIG-SDTAVATLSGTSMASPHVAGLLTYFLSLQPDGDSEFRNKQT---ISPEVLKKKV
IDFGTKDALSSLPA-RTANVLIYNGGGADLSDFWGNKPKKVSGPKF--------------
------------------------------------------------------------
----------------------------------------------------------TY
ADDEEAMGSDLDRLIHELESS---TDAMFSGFRTILDRMNII
>Kpol_1032.5
----------------------------------MKLDKTLVSVATLATLGSSLVIPEF-
-ARDLDDKKLLAKVGNPKDEGVVLGSRRGGVECGTVAVKLDFGSNKKGKIVKKVHHVESG
DESDESDDDEDDHHHGKHGKHGKHGKHGKHGHHHDDDDEDDHHHGKHGKHGKHGHHHDDD
DEDD-----HHHGKHGKHGKHGKHGHH----------------HDDDSKPSDGRKHNPPK
QPVYNIKEDDDIVDSVTQQIFESAEKSGEKV----------KYAPLHSMENTKYENL---
----VIPNKYIIVFKKDVSVKDMQIHKDLIARAQFQYASVSDETSS--------------
-----------SILGGIEEAFNVANLFHGYIGHF-NEQLVQFIRLS-----PIVDFVEQD
SIVHANEVDTQNNAPWGLARISHRDGLNLGSYNKYLY-DDVAGEGVTAYVIDTGINIKHK
EFGGRAVWGKTIPENDQDV-DGNGHGTHCAGTIASKNYGVAKNAEVVAVKVLRSDGSGTM
SDVLKGVEYAAFSHQKALREKK------KG----FKGSTANMSLGGGKSRSLDLAVDAAV
KSGIHFAVAAGNENQDACNSSPAASENAITVGASTLSDDRAYFSNWGKCVDVFAPGLNIL
STYIG-SDEATATLSGTSMASPHVAGLLSYFLSMQPDADSEFFSSGSNS-ISPAQLKKKL
IAYSTKNLFQDLPE-KTPNLLVYN-AGHNISDFWKPKSESSAEP----------------
------------------------------------------------------------
------------------------------------------------------------
--NERAKEFELEDLVDSAQWI---ADTWLNGIQQVFERMDLF
>NDAI0K02880
----------------------------------MK--KTIHKNEKRRNDREYPFEKQEE
HKKKHKKDKKKKH-------------------------------HKPPHHPPKPPHHPYD
APHDGLDHKLPHHPYDAPHDGLDHKLPHHPYDAPHDGLDHKLPHHPYDAPHDGLDHKYPP
STSSSQGSSPQATSHPPHDGPHDGPHHKPPHPPHDGPHDGPHDGPHHKRPDDNKQVSNDK
YSDIFHKYSKQIIESARKLKDNTPNAAGKDQDQDDQDDQDIKLAPLITPTFGDDIHTQGF
KHPRILPNKYIIVFKDSINIDEISYHKELISEIQQQSASRLPPHHHFFHSTSE-------
------EEEESFRNGGIISSFNINNILSGYSGYF-TQEVIDLIRLN-----PLVKYVERD
SIVQTTEFNTQNNAPWGLSRISHRERLNLGSFNKYLY-DDDAGKGVTCFVIDTGINVNHV
DFGKRAIWGKTIPSNDQDI-DGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSM
SDVIKGVEFAAETHLNNEKNKK------D-----YKGSTANMSLGGGKSPTLDLAVNAAV
EAGIHFSVAAGNENQDACNSSPASAENAITVGASTLSDDRAYFSNWGRCVDVFAPGLNIL
STYVGDGNDNTATLSGTSMASPHVAGLLTYFLSLQPDSKSGFFNSKSDGKITPEQLKKKL
IAYSTSDILYDLPD-GTPNKLIYNGAGGDISDLWNGKVQEQAHE----------------
------------------------------------------------------------
------------------------------------------------------------
-EPAHEDKINFENLVDS-DSMSGKTDLFFDQIRNVFEKMNII
>TBLA0A07300
----------------------------------MKLEKTSLVSLATISVASSFLIPAD-
-ERMLRDKLVPQH-------------------------------GKAGADAEHAKHKGGQ
HSVVKHNSA---------------------------------------------------
---------KHHKQSRKQMRVHKHDDS---------------------------------
----------------DSGSDSDSGSDSDGDGDGDGDGDGNYESPAIAPLYSQSLHP---
--QNIIPHRYIITFKKDVAPEEIDFHQQSINELQQQSIAQLPHDHPYFNSVEG-------
----------LDLQQPIIDSFNINSLLQGYIGYF-TDDVIDFIRLN-----PLVQFVEQD
STVNINEFDTQNGAPWGLARISHRERLNLGSFNKYLF-DDKAGEGVTAYVIDTGVNVEHN
DFEGRASWGKTIPNNDEDL-DGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSM
SDVLKGVEYATASHLADVKNKK------SG----FKGSTANMSLGGGKSPSLDLAVNAAV
KAGIHFAVAAGNENQDACNTSPASAKYAITVGASTLSDDRAYFSNWGKCVDVFAPGLNIL
STYIG-SDDATATLSGTSMASPHVAGLLSYFLSLQPEQDSEFATSRKGG-ITPAQLKKRL
ISYGTKDILLDIPE-LTPNVLVFNGAGQDLSDFWNIS-----------------------
------------------------------------------------------------
------------------------------------------------------------
----KPADLESNEVYKNLDLV---GDVLYDQFTGIFKKMNLL
>NCAS0F00220
----------------------------------MKIEKTVLPIAALAALGSALVIPNLA
KEDKDKLAINNKK------------------------------FNDITDVVAKYSEQIIE
SA----------------------------------------------------------
---------RKIGKSVQDSVNLKMAPL---------------------------------
--------------------------------------VTPTPYPVVSGASANSNAN---
--SNIIPNRYIVVFKKSILPEEVDFHKELINQIQLESAAKLPKDDKFFSASAI-------
-------EDESINQGGILTTFNISNLLNGYVGYF-TDEVLELIRMN-----PLVEYVEKD
SLVQATEFDNQNNAPWGLARISHRERLNLGSFNKYLY-DDDAGKGVTCYVIDTGINTEHN
DFNKRAVWGKTIPLNDKDI-DGNGHGTHCAGTIASTHYGVAKNAEVVAVKVLRSNGSGSM
SDVIKGVEFAAESHIKAAKEKK------KG----FKGSTANMSLGGGKSPTLDLAVNAAV
DAGIHFAVAAGNENQDACNTSPASAERAITVGASTLSDDRAYFSNWGKCVDIFAPGLNIL
STYIG-DDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFDPTE---LTPAQMKKKL
INYSSKDVLFDLPE-GTPNKLIFNGAGGNLDDLWNKKSQEEDIKVKGGCDHKKHKGKKHG
SKDHKKHDGPKDHKKHDGPHGPHDPERHHRPEDHDGPRGPHGPHDPERHHRPEDHDGPKD
HKKHDGPHGPHDPERHHRPEDHAGPHHPDDHGGHKKHDGPHHPEDHKDHKKHDGEEDHKD
NKKHHQEQISPADLAKSLGTS---SDSVFQQIRDMFDRMDIL
>CAGL0B03619g
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
----MVPHKYIVVLKKGVSPEAVATFLNDVSAAHAAAIRDLPKEHDFFNFVNA-------
---------EGLPRGGIKDLFNINDLFQGLIGYF-PEPVVKLLEKS-----DIVEFVERD
SVVHASNFDTQNNAPWGLARISHRDRLNLGNFNKYLY-DNAGGEGVTAYVIDTGINVKHV
EFDGRAQWGKTIPLNDLDI-DGNGHGTHCAGTIASKHYGIAKKANVVAVKVLKSDGSGTM
SDVIKGVEYAAQAHLKESKNNK------K-----FKGSTANMSLGGGKSPALDMAVNAAV
SAGIHFAVAAGNENQDACNTSPASAEKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNIL
STYIGDTNRETASLSGTSMASPHVAGLLTYFLSLQPDSDSEFYDASKHG-VTPAQLKKKL
IAYSTKNVLTDLPDPDSPNLLIYNGAGGDLGVFWNSTSADEQSA----------------
------------------------------------------------------------
----------------------------------------------------------EH
PEQRIAAELGLDSLAKMVGDRHAATDSLFGQVRNLLDKMNII
>Suva_5.7
----------------------------------MKLQNTLFTLGALGGISAALVIPNLE
DTADHRELMGKED------------------------------------HHDGPKHAEFV
EDNDRHDER-------PPHKKGRKE--RKDVESKDKDDEDRHARKHRKGEHMDAKDDSSD
DED------KPHGKGGCHGKK-DMKAK--------GKKHHEKESVEDKEHHGEESEKGKK
AKGKKHHGKELEKGKEHHGKKHHGKELEKGKEPHGKDHHRGKLAPLVSTEQFNPDAI---
--TKIIPNRYIIVFKKDVPPEEAAFHRETVQQAQLQSVENLAAEDAFFISTRD-------
------AALSSSEAGGIQDSFNIDSLFSGYIGYF-TQEIVDLIRQN-----PLVDFVEKD
SVVEATDFDTQNSAPWGLARVSHRERLNLGSFNKYLY-DDDAGRGVTSYVIDTGVNVNHK
DFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTM
SDVLKGVEYAAKAHQKQAEEKK------KG----FKGSTANMSLGGGKSPALDLAVNAAV
EAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNYGKCVDVFAPGLNIL
STYIG-SDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDS-LTPQQLKKKL
IHYSTKDILFDIPD-DTPNALIYNGGGQDLSAFWNDTKKSHSSS----------------
------------------------------------------------------------
------------------------------------------------------------
---GFKQELNLDEFIGSK------TDLIFEQVRDVLDKLNII
>YEL060C
----------------------------------MKLENTLFTLGALGSISAALVIPNLE
NAADHHELINKED------------------------------------HHERPRKVEFT
KDDDEEPSDSEDKEHGKFHKKGRKGQDKESPEFNGKRASGSHGSAHEGGKGMKPKHESSN
DDDNDDKKKKPHHKGGCHENKVEEKKM-----------------------------KGKK
VK----------------GKKHHEKTLEKGR-------HHNRLAPLVSTAQFNPDAI---
--SKIIPNRYIIVFKRGAPQEEIDFHKENVQQAQLQSVENLSAEDAFFISTKD-------
------TSLSTSEAGGIQDSFNIDNLFSGYIGYF-TQEIVDLIRQN-----PLVDFVERD
SIVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLY-DDDAGRGVTSYVIDTGVNINHK
DFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTM
SDVVKGVEYAAKAHQKEAQEKK------KG----FKGSTANMSLGGGKSPALDLAVNAAV
EVGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNIL
STYIG-SDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDS-LTPQQLKKKL
IHYSTKDILFDIPE-DTPNVLIYNGGGQDLSAFWNDTKKSHSSG----------------
------------------------------------------------------------
------------------------------------------------------------
----FKQELNMDEFIGSK------TDLIFDQVRDILDKLNII
>Skud_5.29
----------------------------------MKLENTLLTLGALGSISAALVIPNLE
HAADHHELVVEDN------------------------------------HQERVGHAVHA
GGSSHESAK-------ESHEDGKHG------------------------------DEEAS
KSDD-----KAHRKGGCHDKK-DKKDK-----------------------------KDKK
VKSKKEKKVKSKKEKKVKSKKHHEKTLEKAR-------HNEKLAPLVSTAQFDPAAM---
--PKIIPNRYIIVFKKGVPQEATDFHKESVHQAQLQSVENLSAEDAFFISTRD-------
------SSLSTSETGGIQDSFNIDNMFSGYIGYF-TQEIIDLIRQN-----PLVDFVERD
SVVEATDFDTQNSAPWGLARISHRERLNLGSFNKYLY-DDDAGRGVTSYVIDTGVNVNHK
DFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTM
SDVVKGVEYAARAHQKQAQEKK------KG----FKGSTANMSLGGGKSPALDLAVNAAV
EAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDIFAPGLNIL
STYIG-SDDATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFEMGQDS-LTPQQLKNKL
IHYSTKDILFDVPE-DTPNALIYNGGGQDLSAFWNDTKKSHSSR----------------
------------------------------------------------------------
------------------------------------------------------------
----FKQELNMDEFI---GSK---TDLIFEQVRDVLDKLNII
>Smik_5.27
----------------------------------MKLENTLFTLGALGSISAALVIPNLE
NAADNHELVSKDK------------------------------------DQETSGNLKFA
SGDGEKSIK-------KGHSGGGHG--------------GSHRNGHTGGKGTKSEEGESS
DDED-----KPHRKGGCHDKK-KKKGK-----------------------------KGKK
VK----------------SKKHDGKTLEKGR-------PNNKLAPLVSTAQFNPDAI---
--SKIIPNRYIVVFKKGVPEEEVNFHKESVHQAQLQSVENLSAEDAFFTSTRD-------
------TYLSTSEAGGIQDSFNIDNIFSGYIGYF-TQEIIDLIRQN-----PLVDFVERD
SVVEATEFDTQNSAPWGLARISHRERLNLGSFNKYLY-DDDAGRGVTSYVIDTGVNINHK
DFEKRAIWGKTIPLNDEDL-DGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGTM
SDVVKGVEYAAKAHQKQAQEKK------KG----FKGSTANMSLGGGKSPALDLAVNAAV
EAGIHFAVAAGNENQDACNTSPASADKAITVGASTLSDDRAYFSNWGKCVDVFAPGLNIL
STYIG-SDEATATLSGTSMASPHVAGLLTYFLSLQPGSDSEFFELGQDS-LTPQQLKKKL
IHYSTKDILFDIPE-DTPNFLIYNGGGQDLSAFWNDTKKSHPSG----------------
------------------------------------------------------------
------------------------------------------------------------
----SKHELNMDEFIGSK------TDLLFEQVRDVLDKLNII
>KLLA0D00979g
----------------------------------MKFENTLLTITALSTVATALVIPEVN
RENKHGDKSVAIK-------------------------------DHASSDLDKPQHHANG
KA----------------------------------------------------------
---------RSKSRGRCADSK---------------------------------------
--------------------------------------KFDKLRPVDDASAILAPLSTVN
DIANKIPNRYIIVFKKDASADEVKFHQELVSVEHAKALGSLADNDPFFTATSG-------
-EHSEFGVKAHSLEGGIQDSFDIAGSLSGYVGYF-TKEVIDFIRRS-----PLVEFVEED
SMVFSNSFNTQNSAPWGLARISHREKLNLGSFNKYLY-DDDAGKGVTAYVVDTGVNVNHK
DFDGRAVWGKTIPKDDPDV-DGNGHGTHCAGTIGSVHYGVAKNADIVAVKVLRSNGSGTM
SDVVKGVEYVAEAHKKAVEEQK------KG----FKGSTANMSLGGGKSPALDLAVNAAV
KAGVHFAVAAGNENQDACNTSPAAAENAITVGASTLSDERAYFSNWGKCVDIFGPGLNIL
STYIG-SDTATATLSGTSMATPHVVGLLTYFLSLQPDADSEYFHAAGG--ITPSQLKKKL
IDFSTKNVLSDLPE-DTVNYLIYNGGGQDLDDLWGKDYSIGKEP----------------
------------------------------------------------------------
------------------------------------------------------------
---SANPEFSLESLINSLDSK---TDAIFDDVRQLLDQFNII
>TDEL0G04550
----------------------------------MRFEQTVLPVAALASLGAALVIPELK
GKVLCHGKDKALD-------------------------------HPKDKALDHPRERPQH
RGPRRGPRRGPPPPLP--------------------------------------------
---------EGRHDGPSHEGHHDALPE---------------------------------
-----------------------------------------HRGIVHKMGEGVAPLS---
IPPNAFPHRYIVVLKHS-SPEEIALHMEAITQSQLQSVGELAQDDPFFSAQGV-------
-----------RTTGGIQDSFDVAGLLNGYVGYF-TDAVVELIRKS-----PMVDFVEMD
SPVHASEFDTQNGAPWGLSRISHRERLNLGSFNKYLF-DDEAGKGVTSYVIDTGINVKHQ
DFEGRAHWGKTIPTNDEDL-DGNGHGTHCAGTIASKHYGVAKGADVVAVKVLRSNGSGSM
SDVIKGVEFAAQSHQKAVKDKK------KG----FKGSTANMSLGGGKSPALDLAVNAAV
KAGIHFAVAAGNENQDACNTSPAAAEQAVTVGASTLSDDRAYFSNYGKCVDIFAPGLNIL
STYIG-SDDATATLSGTSMASPHVAGLLTYFLSLQPDSDSDFFDAGSQG-VTPEQLKKKL
IAYSTKDILYDLPE-DTPNALIYNGGGHGLKGFWDGHDKQEANT----------------
------------------------------------------------------------
------------------------------------------------------------
----RFQDTDLQELSDNLGAK---TDALFDQVRDVLDRLNII
>SAKL0E01012g
----------------------------------MKVQSTILPIAALTTLAAALVIPEV-
DKSSKDVSVKEIN--------------------------------------SDSQEVLAS
FA----------------------------------------------------------
---------KEITRAAAEKGE---------------------------------------
---------------------------------------EVKLAPLVS-----SPQP---
--ANIIPHRYIIVFKKDATPEEISFHKEIISEAHAESVAKLDSKDSFFAATKG-------
-SADEYGIAAKSSEGGIQESFDIANMLNGYIGYF-TDEVVDFIRMN-----QWVEFIEKD
SLVFASEFDTQNGAPWGLSRISHRERLNLGSFNKYLY-DDDAGKGVTSYVIDTGINVNHK
DFNGRAVWGKTVPQNDEDA-DGNGHGTHCAGTIASEHYGVAKNAEVVAIKVLRSNGSGTM
SDVVKGVEFAAQSHQEASKKNK------KG----FKGSTANMSLGGGKSPALDLAVNAAV
KAGIHFAVAAGNENQDACNTSPAAAENAITVGASTLSDDRAYFSNWGKCVDIFAPGLNVL
STYIG-SETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEFFQASG---ITPAQLKKKL
IAYSTKDVLYELPE-DTPNYLIYNGGGQDLSDFWGKSEEQVKEE----------------
------------------------------------------------------------
------------------------------------------------------------
GSIQDFKDFKLSELIESFDTK---TDLLFEEVRSVFDKLNII
>KLTH0C11396g
----------------------------------MKL-QTALPVAVVASVGAALVLPDLE
EASNTVALKVKDV-------------------------------------ITAGESIVSS
FS----------------------------------------------------------
---------KQMTKDAASKGE---------------------------------------
---------------------------------------SVELSPLVSSSGK--------
--YLAIPHRYIVVFKQNLSPEEVDFHKQIVSEAHLQSVAKLESTHEFFTSTENFVEDRDF
ELDYQRSFSAQTREGGIQDSFDVSGLLTGYIGYF-TDEIVDFIRMN-----PLVDFVEQD
SVVFAQEFGTQNGAPWGLSRISHREKLNLGSFNKYLY-DDDAGKGVTSYVIDTGVNVDHK
DFEGRASWGKTIPTNDLDQ-DGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSM
SDVVKGVEFAAKSHQDAVKENK------KG----FKGSTANMSLGGGKSPALDMAVNAAV
KAGIHFAVAAGNENQDACNSSPASAENAVTVGASTLADDRAYFSNWGKCVDIFAPGLNVL
STYIG-SDTATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGG--ITPSQLKKKL
IAYSTKNVLGDIPD-DTVNYLIFNGGGEGLDDFWGKESVVDEVE----------------
------------------------------------------------------------
------------------------------------------------------------
----DTISSEIESFIDALEEK---TDVLYEEIREVFDHMNII
>Kwal_56.22387
----------------------------------MKL-QTTLPVAMVAALASALVLPEV-
-EEASKDALVAVE----------------------------------ETAASLGESILSS
FS----------------------------------------------------------
---------KEVTKKAAESGA---------------------------------------
---------------------------------------GVTLSPLVT-----ARNM---
--YDAIPHRYIVVFKDRVLPEEVDFHMEVVSEAHAQSVGKLDANDAFFEATMD-------
---EEMGIMATSREGGILDSFDVNGMLRGYIGYF-TQEIVDFIRMN-----PLVAFVEQD
SMVYANEFDTQNGAPWGLSRISHREKLNLGSFNKYLY-DDAAGKGVTSYVIDTGINIDHK
DFEGRAAWGKTVPTNDLDQ-DGNGHGTHCAGTIASKHYGVAKNANVVAVKVLRSNGSGSM
SDVVKGVEFAAKSHQDAVKKNK------KG----FKGSTANMSLGGGKSPALDMAVNAAV
KAGIHFAVAAGNENQDACNSSPAAAENAITVGASTLADDRAYFSNWGKCVDIFAPGLNVL
STYIG-SETATATLSGTSMASPHVAGLLTYFLSLQPDSDSEYFHAAGG--ITPSQLKKKL
IAYSTKNALGDLPE-DTVNYLIYNGGGQDLDDFWVKDLEEKVAD----------------
------------------------------------------------------------
------------------------------------------------------------
--AKDNTASEFESIIDALEEK---TDGLYEEIREIFEGLNII
>KAFR0B06550
----------------------------------MNPLLFWYTSFVLTGGCLSLLLPEIF
QCRGIETISQKDR-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------DSTFSRTEVLEHLSAKQN---
---DIIKDQYIVIFKNSAMMAEKELHFKQLKNFIKTYSYEWDEKDDH-------------
--------------KSNLNIFKIGTTLSGYILRG-PIETLQLLRQD-----PIVQLIEPD
SKVHALKLKIQEDTPWGLSRISQRPRVRIGQDQLYYY-DDATSGNVTAYVLDTGIMISHE
QFNGRARWGKTIVPNDVDE-DNSGHGTHVAGIIASDKFGVAKTCEVVAVKVLRSNGEGDM
SDVLKGIEFVVDDHSKNKNYS--------------KGSVVNLSLGASKSPALVLAIDAAI
SENIHFAVAAGNENMDACYTSPADARRAITVGASIFSDERAFFSNWGECVDVFAPGMNVM
STYIG-SDNATLSLSGTSAAAPYTAGLIAYYLSLQPDKDSGYFTGE----MTPSKLKEKI
VAFGSKDVLYELPE-NTPNIVIYNGAGRNLSHFWKDY-----------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------
>NDAI0I02280
----------------------------------MTLGGTLLILSWFARSITSLIIPEII
HSGNNDASHAKLN-----------------------------------------------
------------------------------------------------------------
---------ERDTLDK--------------------------------------------
-----------------------------------------NQIPFIIPTHGPQKNF---
-----IPDQYIVLFENDTTDLQISRFEQFLSSLIEEDNQKYNVNDNY-------------
--------------SKVLSRFQISNDTKGMIIRAPIDDFLEDVKNNIFNYQKIIKIIERD
SYVHMNKFTTQIDSSWGLSRISQRNHLKLLQDQFYFYDDNGSGKGVDCYILDTGINSNHI
EFEGRASWGVSLPVTEPSLEDSNGHGTHCAGIIGSKTYGVAKETNLIAVKVLDFKGDGSM
SDVILGLEFVANSHTNKTNNISSSSSVHSE----FKGSVVNLSLGAPKSPSLDIALESAK
KIGIHITVAAGNEDEDACMTSPADSPAVITVGASSFSDDRAFFSNWGPCVDVFAPGINIK
STYIGPNNNETLSLSGSSMSSPFVSGLTAYYLSLQPDVSSQFHDSL----MTPDQLKRKI
IDFSTNGMLKELPL-DTANKLVYNGGGKDLSGFWNATRKEN-------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------
>NCAS0D02630
----------------------------------MKLLR-LISICLLTRIGYSLVIPSIW
AQTGKSPGVFNID-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------SDSPSNI-----IHHA---
--ASPIPNQYIVLFKSDTTDIQRETHLATLNSW-------LLNTDPQYT-----------
----------------ILHSFQLAHDLQGYTSRL-PEQLIRSLATD-----PIIQSIEQD
SYVHALGRQKQIDSPWGLARISQRERLKLLQDQFYHYDDSGASSNTKCYILDTGINENHN
EFQGRAKWGAVFTPMEPNQEDENGHGTHCAGVIGSHEYGVAKNTTLIAVKVLDARGDGEM
SAVIRGIEYVTQQHEQDMKKQD-----QTG----FKGSVINLSLGAGKSPALLRVIEAAV
KLGVHFAVAAGNEDDDACSTSPADSPHALTVGASSFSDDRVFFSNWGPCVDVFAPGINIM
STYIGPHNNETTSLSGTSMSAPFVTGLIAYFLSLQPDTKSQFYTGITS--PTPYQLKYKI
ISFSTEGVLHEIPE-GTPNRIVYNGGGHSLKDFWNN------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------