MUSCLE (3.8) multiple sequence alignment

KLTH0C11308g       --------------MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTI
Kwal_56.22411      --------------MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTI
KLLA0D01067g       --------------MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTI
SAKL0E01100g       --------------MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTI
ACR009W            -------MPPALEKMPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTI
Ecym_3021          --------------MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTI
TBLA0G01010        --------------MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTI
CAGL0L13288g       --------------MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSI
NDAI0D00860        ------MHNISNLNSINHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAI
NCAS0H00870        -------MQNSNLNNLNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTI
KNAG0M01140        --------------MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAI
KAFR0L00380        --------------MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSI
Smik_5.25          --------------MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTI
YEL062W            --------------MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTF
Skud_5.27          --------------MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTI
Suva_5.5           --------------MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTI
ZYRO0C07876g       MSLRYIQACANTGRMTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAI
TDEL0G04520        --------------MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAI
Kpol_1045.72       ---------------MVGFDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSI
TPHA0J00310        --------------MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAI
                                     *:**  :* :::: ****:*.:: .::*.  *    * *:::

KLTH0C11308g       KNYVIPKPQLCNKLLTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEP
Kwal_56.22411      KNYVIPKPQLCNKLLTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYES
KLLA0D01067g       KNYIIPKPQLCNKLLTFKYGEYRIVCYPVNVNARYYARNSFNFNFVFVFPYDCATSPYEP
SAKL0E01100g       KNYVIPKPQLCNKLLTFKYGPYRLACYPVNVNASYYARNSFNFNFVFVFPYNCATSPYEP
ACR009W            KNYVIPKSQLCNKLVTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEP
Ecym_3021          KNYVIPKPQLCNKLLTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEP
TBLA0G01010        KNYIIPKPQLCHKLLTLKYGDYRLVSYPVTINSSLYARNFFSFNFVFVFPINCETSPYEP
CAGL0L13288g       KNYVIPKRALCHRLITFKYGNYRIACYPVTVNSSIYARNFFSFNFVFVFPFNCETSPYEP
NDAI0D00860        KNYIIPKKQLCNKLLTFKYANYRIVSYPITINSDFYARNFFSFNFVFVFPYDCETSPYEP
NCAS0H00870        KNYIIPKNQLCNRLLTFKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEP
KNAG0M01140        KNYIIPKPQLCHRLLTMKYGNYRIVSYPVAVQSSSYARNYFRFNFVFVFPYECATSPYEP
KAFR0L00380        KNFVIPKPQLCHRLLTLEYKNYRLVSYPVNVSSSSYARNFFSFNFVFIFSYDCQTLPYEP
Smik_5.25          KNYIIPKPVLCHKLITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEP
YEL062W            KNYIIPKPILCHKLITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEP
Skud_5.27          KNYIIPKPILCHKLITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEP
Suva_5.5           KNYIIPKPILCHKLITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEP
ZYRO0C07876g       KNYIIPKPQLCHKLLTLKYKGYRIVCYPVTVNSPYYARNFFSFNFVFVFPYDCETSSYEP
TDEL0G04520        KNYIIPKPQLCHKLLTLKYKNYRIASYPVTVNSPIYARNFFSFNFVFVFPYDCQTSPYEP
Kpol_1045.72       RSYVIPKPQLCNKLLTLKYGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYES
TPHA0J00310        KNYVIPKPQLCHKLLTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEP
                   ..::***  **:.*:*:::  :*:  **: : .  **** * *::**:*. :. * .**.

KLTH0C11308g       AIERLGKMFTVLEEQSQILSKAENSSVYF--QLK------------ARNTQKHGN----T
Kwal_56.22411      AIARLGKMFTVLEEQSQILSKAENSHVYF--QLK------------TRDSHKHTN----Q
KLLA0D01067g       AIARLGKMFKVLEEQSQILSKSEQNPVYF--QLK------------SNDSNAAD-----Q
SAKL0E01100g       AVARLGKMFRVLEEQSQILSKAENDPVYF--HLK------------SQESSTNSSSHP-V
ACR009W            AIARLAKMLRVLEEQSQMLSKVERDPVYY--QLK------------TGETKAAE-----Q
Ecym_3021          AIGRLGKMFRVLEEQSQVLSKIERDPIYY--HLK------------TQDVKAVD-----Q
TBLA0G01010        IIARLGKMFRVLEEQNQLLSRAENDSVYF-------------------DNSHSL-----L
CAGL0L13288g       AIERLGKMFRVLEIQNQILSKSENDTIMF--NLK------------SADKNFNI-----D
NDAI0D00860        AIARLGKMFKVLEEQNQILSKAENDPIYFKSDYTPYQPTLIIPTNNDNDGKRNKKLMKKE
NCAS0H00870        SIARLGKMFKILEEQSQILSKAENDPIYFKSDYV------------PTEPTTTI-----I
KNAG0M01140        AITRLGKMFRVLEEQSQVLSRAERDDSLF------------------------------K
KAFR0L00380        AIERLGKMFKTLEEQSQILSKSQRTSAFF-------------------------------
Smik_5.25          AITRLGKMFKVLEEQNQLLSKSEKDPVFF--DLK------------ALENSTIA-----P
YEL062W            AITRLGKMFKVLEEQNQLLSKSERDPVFF--DLK------------VLENSTTT-----P
Skud_5.27          AITRLGKMFKVLEEQNQLLSKSEKDAVFF--DLK------------ALENSTIT-----P
Suva_5.5           AITRLGKMFKVLEEQNQLLSKSERDPVFF--DLK------------AIENSLLT-----P
ZYRO0C07876g       AIARLGKMFRVLEEQNQILSKAENDPIYF--DFK------------LADNTTEQ-----D
TDEL0G04520        AIARLGKMFKVLEEQNLILSKAEKDPIFY--HFK------------QVEIKDDQ-----D
Kpol_1045.72       VIVKLGKMFRVLEEQSQFLSKAEKDLAYF--DFK-----------AILHSSLDQDSKLKP
TPHA0J00310        VVERLGKMFCELEGQCQFLSKCEKDMAYF--DFK------LISNLIDQDKSNTEPDNNIL
                    : .*.**:  ** *  .**. :.    :                               

KLTH0C11308g       ETAKGTEQPSSLD---------IGEIAQPENQGYASAKYYEILKDLEGPSKKIAIGDLIT
Kwal_56.22411      EPVNDNELQGTLK---------NNEASQSESHGYAFEKYHEILKDLNGPNKRISVEDLIT
KLLA0D01067g       STEMGSITISEHT--------------DIKSTGDDGEKYLEIIKELAKNQKSLIIEDLLM
SAKL0E01100g       DQGGSDRPKDTEQGTGLNNSQDSKEQGKIEGQGAAIEKYHEIMDDLEKGKKRLSIEDLIT
ACR009W            KTEESDSKAKTHN-----------LDKKSRAQHNATTKYHEIMKHINSDEKNLYIEDLIT
Ecym_3021          NSEEPESKNNPQN---------CNDKIRRGHHEHAFEKYHEIMKHIAMNEKQLSIEDLIT
TBLA0G01010        SSEQDSIMHQDKN-TSILGFSRKRFSFSKRPTDLSLSEYPDN-----ESGSNFSVQDLIM
CAGL0L13288g       NDSSNYILGDDIS------------SIMTTQQKDKYERLNNIISNIKKKPSNFTISDLLM
NDAI0D00860        NTIFSTRQQRSNSNRILEENSNSNSNSNSNSNGNENDNNYNTIEQYLNNNSRISVQDLIM
NCAS0H00870        PQISPSHRNKRNN------------DHNDNNDGSRFET--DFFGEEEDGVTKFSVQDLIM
KNAG0M01140        GDKLPFDNNSAKN------------QAPLTHALISKTKSFSPDKKTEGDIHLISVQDLIM
KAFR0L00380        ----------------------------------------KDGEDVDFVDTKFSIQDLLM
Smik_5.25          STACPPATSNTSSNTTPTHPTSDKDAKDLRNS-----RYNDLVKDFELPESTFSIQDLLM
YEL062W            STAGPSSTPNPSSNTTPTHPTSEKDTKDMRSS-----RYSDLIKDLGLPQSAFSIQDLLM
Skud_5.27          STAGAPTTSNPSSNTTPTYPTSDKDAKDLRSS-----RYNDLTKDLGLPESSFSIQDLLM
Suva_5.5           STAGPPATSNPSSNTTPTHPTSDKDAKDLRSNRFNGEKYNDIIKDLGLPESTFSIQDLLM
ZYRO0C07876g       GKLNAEKSFKGLT----------------KSQGMALAKYNEIMKDLESEKSDFSVQDLVM
TDEL0G04520        AKSKPEKGSHNLS----------------KSQAYASEKYHKIMTDIESADSTFSLKDLVL
Kpol_1045.72       EKDSSGNNNGNSNNSNNDQSNSANATDSKKNSSYLFEKYKEIQEFVSNDESDFSIQDFIM
TPHA0J00310        SKTNSMILPTISNIDTTVGSTNTQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILM
                                                                       : : *:: 

KLTH0C11308g       KIYRDLNDYSECLIPIDSGNAVDIKLFPLLSPPSSC-FSIEDVPISTVNLAKLIDVNWDP
Kwal_56.22411      KIYRDLNNYSECLIPIDSGNAVDIKLFPLLSPPSSC-LSFEDVPMPTVNLAKLIDVNWDP
KLLA0D01067g       KLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSN-ISVEDVPIAVVNLSDIIDVNWDP
SAKL0E01100g       KLYQDLNNYSECFIPIDSGNSVDIKLFPLLAPPNSC-LSFEDVPISTVNLAKLIDVNWDP
ACR009W            KLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSC-LSFEDVPIAKVNLMNLVDVNWDP
Ecym_3021          KLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSC-FSVEDVPIAKLNLIDWVDVNWDP
TBLA0G01010        RIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPPSIS-ISYEDVPVAMVDLSHVMDVNWDP
CAGL0L13288g       RLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPY-ISIEHVPISLVNLFKIVDVNWDP
NDAI0D00860        RIYQDLNNYSECLIPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDP
NCAS0H00870        RIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMSLINLNNVIDVNWDP
KNAG0M01140        RIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLSIEDVPMLVVKLKKIIDLNWDP
KAFR0L00380        RLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIEDVPLSIVNLDKIVDLNWDP
Smik_5.25          RIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTC-VSLEDVPLSSVNLEKIIDVNWDP
YEL062W            RIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTC-VSLEDVPLSSVNLKKIIDVNWDP
Skud_5.27          RIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTC-VSLEDVPLSSVNLKKIIDVNWDP
Suva_5.5           RIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPPTTC-VSLEDVPLSSVNLKKIIDVNWDP
ZYRO0C07876g       RIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNSC-ISIEDVPISTVNLKTIIDVNWDP
TDEL0G04520        RVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNSN-ISIEDVPVSTVNLNKVIDVNWDP
Kpol_1045.72       RLYQDLNNYSECLIPIDAGNAVDIKLFPLLRPPPAT-ISIEDVPISRVNLKEIIDVNWDP
TPHA0J00310        RVFQDLNSYSECYIPIDDGNAIDIKLFPTLMPPIDS-ISVEDVPIPTVNLNKIIDVNWDP
                   .:: *** **** **:* ** ::**:**   **    .* * **:  :.*    *:****

KLTH0C11308g       TMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYYNCVILTDIFQFSNIYASTNEL
Kwal_56.22411      TMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYYNCVILADIFQFQNIYAPTSEL
KLLA0D01067g       TMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYYNCVILSDIFQFSNIYAPTSEI
SAKL0E01100g       TMLKIVPFINGVNSIAKIAKFSSSDTDLVIECVKHLIYYNCVVLADIFQFSNIYASTSLI
ACR009W            TMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYYDCVALVDMFQFSNIYAPTNLL
Ecym_3021          TMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYYDCVVLVDMFQFSNIYAPTSQL
TBLA0G01010        TMLKIVPFIDSINSISRIAALSNSDVDFVVECIRHLVYYQLVILSDIFQFTNIYAPTSRL
CAGL0L13288g       IMLTIIPYINGINNIYRISQLSHNEESLVIECIRHLVYYRCIVLTDIFEFSNVYAPTSSL
NDAI0D00860        TMLKLIPFINGINDISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLI
NCAS0H00870        TMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQFSNVYAPTSLI
KNAG0M01140        TMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYKCVIITDIFQFSNIYAPSSLI
KAFR0L00380        TMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNCVIITDIFQFSNIYAPSSLI
Smik_5.25          TMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSSI
YEL062W            TMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLI
Skud_5.27          TMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLI
Suva_5.5           TMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLI
ZYRO0C07876g       TMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYYNCVILADIFQFSNIYAPTSLI
TDEL0G04520        TMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNCVLLADIFQFSNIYAPTSSL
Kpol_1045.72       TMLKIVPHIDGVNSIAKIAKLSDSDTVLVIECIKHFIYYGCVVISDIFQFSNIYAPTSLL
TPHA0J00310        TMLKIVPYIDGLNSIFKIANLSNSDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSI
                    *: ::*.*:. *.: .::  :     :* **:.*::**  : : *:*:* * *:.:. :

KLTH0C11308g       SRFLTEPTLAAECQIYVAYNESAHLPNL---PFERGPSRSGQGNIRDRSSNGTLDILRKG
Kwal_56.22411      SRFLTNPALATECQIYVTLDESTHISDL---PFERKPSRTTYNNIPVRNSSSTLDVQRKG
KLLA0D01067g       HNFLTNPAVAKACQLFVQ-GDSLKQSLL---PFEGRPN-NIYPTGRKQASTSTVHSRRRD
SAKL0E01100g       SEFLTDPTLASECQTYVT-SSDLELYRL---PFESRPNLLSMHSSRKQNSSSTIHTVGVR
ACR009W            RDFLFDFILPRECQVYVVSSEDCEIHRL---PFESRPN---GGHSRNQTASTNTVYTLRR
Ecym_3021          SEFLTDPSIARECQLYVISSEDSELHQL---PFEGRPN---ANHSRNPTASTITFGTLKR
TBLA0G01010        RDFLTDINLATDCQTYVCLPKNSNFGKL---PLEKSINTDLDEYSNSGSAIYPNNEILE-
CAGL0L13288g       RLFLLDPNMATECQSYVMLPINSKMNDLSLYPHHGKHSAFNGDIGSRNNSV---------
NDAI0D00860        STFLTDPNMATLCQNYVVLPLGSKLTRL---PFHIETETSVQSSSAYRHHHNR-------
NCAS0H00870        CSFLTDQEMATQCQNYVVLPIGSKLSHL---PFE--------NNGNKQPSTPK-------
KNAG0M01140        NEFLTDPTMAYDCQEYVTLPKSSRLIHM---PLQTSVPGSRNNKHKKSNSLS--------
KAFR0L00380        NNFLRDPMIAFNCQSYVVLPPGSKINDL---PLASEQDDEINNSDMTQKAL---------
Smik_5.25          RNFLTDPLMANDCQYYVTFPEVSKISSL---PLNKNLTSGDLDSPSFSVRRKSKSSSIPS
YEL062W            RNFLTDPLMASDCQSYVTFPEVSKISNL---PLNKSLGSGDQDSPSFSVRRKSKSSSIPS
Skud_5.27          RTFLTDQLMASDCQSYVAFPEISKMSSL---PLSKNLDSADRDSPSLFVRRKSKSSSIPS
Suva_5.5           RNFLTDPLMATDCQSYVTFPEISKLSNL---PLNKNFDSVDQDLTSFSVRRKSKSSSVPS
ZYRO0C07876g       RQFLTDPTLASECQSHVTLAGHSSLSEM---PFERLRKFDLDDMDQSKNQES--------
TDEL0G04520        RTFLTDSVLSTECQSYVVCEEDSTLPRL---PFKRVNHSATESVDHELADSHRSQRTS--
Kpol_1045.72       RNFLTDPLMATECQTYVTVPESSTLHQL---PLESLSKLKLDSDGSDSQNLRKSKNGI--
TPHA0J00310        TDFLTDPTLATECQIYVTSPEDSLLSAL---PFKKGRKMVKNRRSASIASHFTSSSSLRQ
                     ** :  :.  ** .*          :   *                            

KLTH0C11308g       KQT-PLRENSFNSGMDFLSNKHQHTPQ--SRSSSIPYHNTSDASFGNSDAGLKGKL-M--
Kwal_56.22411      REM-SIKESSFTAGID-QSGRNQYTPQ--SHTSSIQCHNVSDASLGNSEGGFNNKV----
KLLA0D01067g       SN--DTATTGSTSSVR-DTHRNYLSSS--STSSYFRAHASENTSLATGENQMKR------
SAKL0E01100g       NS--PNRTNSLDYPSELSTRRNNFSSS--SASSLMRVRDRSGQSTTGSAVDEQESR-L--
ACR009W            TTS-TNRADSFSSNAE-FSQKSSGISS--LAQSF--TQSNKDYYYNRSRNLESNCK-R--
Ecym_3021          TIYTNPRPESFSSNTE-FAQKPNANTS--LPSEPSITHSSKNSEFNHENNKGILNR----
TBLA0G01010        ----NDDRLRWPMYYK---------------------PRNSQSSLSSGISSGNERT-SN-
CAGL0L13288g       ----STSLYSFNGNDSRPQSRSSSVDQ--SQTNFYKNKKQSESSISTGNSNNGQNI-HK-
NDAI0D00860        ----HEKTPSFGSSIT-SNNGRSSFSA--D------DRKQSETSLNSSNDPSNSNL-IST
NCAS0H00870        ----HSRTTSLSSSMS------GSVNS--HEHSYMDTIQKSETSLSLSSTDPNNPH-FEL
KNAG0M01140        ----STGVLSWQSNSQ-YSNNSSEFYS-------MSNKKRSESSLSSEGTPGAGRSDDHT
KAFR0L00380        ----SSSRSSFSSYFS------HKSAY--ARVSETAHHHQSTSTLSSSEGQQDNPR-QGQ
Smik_5.25          NP--GSRTTSFSSTSK--VSQNSSINS--SFSSAYRDWRQSQTSCSSSNIHISNNR-NR-
YEL062W            NP--DSRTTSFSSTSR--VSQNSSLNS--SFSSIYKDWRQSQTSCSSSNIHVINNR-NR-
Skud_5.27          NP--DSRTTSFSSNSK--VSQNSSLNS--SFSSVCKDWRQSQTSLSSSNLRANDNR-NR-
Suva_5.5           NP--NSRTTSFSSTSK--VSQNSSLNS--SFSSVSKDWRQSQTSCSSTNTHAISKR-NQ-
ZYRO0C07876g       ----GSRTTSMSSKSD-SKSKRPFFYS--APRNPYRFNQRSQSSFSSTNTNVTHDL-AR-
TDEL0G04520        ----GSRTTSMSSNGKFFPSSNNEMPALISEESLYRTGKHSQSSFSSNNTNPSNML-AR-
Kpol_1045.72       ----DSRAASFVSSRGASSHNENSSLY--SRSDLYLNRHRSESSISSQNTNDLNGN-VK-
TPHA0J00310        NL--NSKASSFISDEG--HHNDDTAYP--NHDSIYENRRRSESSFSSGNNDEMHQN-RN-
                                                           .                   

KLTH0C11308g       -PFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFITFGVLHGLIYRSYSYP
Kwal_56.22411      -FFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFITFGVIHGLLYRCYSFP
KLLA0D01067g       -ILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITRRLIYRVNSYP
SAKL0E01100g       -LLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDNHIDVRRFITFGIVRGLIYRCYAYP
ACR009W            -TLPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGVFHRLIYRCYSYP
Ecym_3021          -TLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFRKLIYRCYSYP
TBLA0G01010        -YLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFGLVRGLLYRCYAIP
CAGL0L13288g       -HLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFITFGVLRRIIYRCETYS
NDAI0D00860        AHLPTKMSLFELYRSLNQRTDLKNWYKLNYTTIIENNIDIRKFIKFGIIKGLIYRCHSYP
NCAS0H00870        AHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYP
KNAG0M01140        IYYPTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYRVLSYP
KAFR0L00380        -VLPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIYRVHQYP
Smik_5.25          -FLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLEKRIIYRSYSYP
YEL062W            -FLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLEKRIIYRCYSFP
Skud_5.27          -FLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGLERRIIYRCYSFP
Suva_5.5           -FLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFITFGLERSIIYRCYSFP
ZYRO0C07876g       -HLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGLIYRCFSFP
TDEL0G04520        -YLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVINGLIYRCYSYP
Kpol_1045.72       -QLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNGIDIRKFIIFGIINGLLYRCQSFP
TPHA0J00310        -YLPTKSTLFDLYRSLSQGVKLEEWYQINFNSIRDNFIDIRRFIIFGIIKRIIYRCHSYP
                      .:.  **::*.:*     :  **  :   :    :*:*.:* **  . ::**    .

KLTH0C11308g       VLRNIGFAESVEALG-ATNHSRYAKYKHLLKTNQPLNNV---------------------
Kwal_56.22411      IMKNVGYLEVVKALG-LSDGDSSTEGKWLSGNSEPTNNV---------------------
KLLA0D01067g       IVKNVGTWDILKSLVSKEPKTHY--------GSGSSKNI---------------------
SAKL0E01100g       VMKNLGALEMLKTLKSASDSRSLRRKLKFREKKNFTNNV---------------------
ACR009W            VAKSIGTLELLKRFDYVSTTDNFIPT-----GTSAGNNV---------------------
Ecym_3021          VAKSIGTLDMLKRFDYASLPNNFMSP-----KNNNSNNV---------------------
TBLA0G01010        IMKNAGIFDILSSLTTSQSSNPYHSNGDDKNGTASTANIRFLNSITDSDIHDLKDDEINN
CAGL0L13288g       VINSTDHLQNLWKLNELENP----------------------------------------
NDAI0D00860        IV----ITPVVSAPESAKSTSPFVSSSGISSSVDSKQHT---------------------
NCAS0H00870        IPQR-PSNEGIQRIERLNDIDAHRLQIRSSGSAARSNS----------------------
KNAG0M01140        VLEKRRNSIIAKQMGKSKMAEK---------APHSKNAF---------------------
KAFR0L00380        IMEHKTFKSPLLS------------------DRQNDKIV---------------------
Smik_5.25          VMLSVGPRETKETAPIIAKDSP---------NESNSSE----------------------
YEL062W            VMINAGSRE---------------------------------------------------
Skud_5.27          VMLNVDSRE---------------------------------------------------
Suva_5.5           VMIHVGSRD---------------------------------------------------
ZYRO0C07876g       VMKKMSIFDLAHKLHTAGNLNQVTKKGKGQKNLAESKYV---------------------
TDEL0G04520        IMKNLEIFDLAKRLHREDISNHTVKHNK---AKNPSKNI---------------------
Kpol_1045.72       VTANFEEINKVKKFKDIQNRKETRKDKL---QKQLSQDI---------------------
TPHA0J00310        LPKNYEAFSKLNDLKNLQNGPKIVKNK----SQSYTYNI---------------------
                   :                                                           

KLTH0C11308g       ---------LSAADI-----RIGLENAGFKARSEKLKQHSTAD---------------AA
Kwal_56.22411      ---------LSAAEI-----RIGLESSSSKLRERRFNHFSNAD---------------TA
KLLA0D01067g       ---------FSAADI-----KVVD-------TKEEGNQSDKLD---------------AA
SAKL0E01100g       ---------FSTADIKVDLEHSPGGAPAE--IFNRKHTSNV-D---------------MA
ACR009W            ---------FSTSDI-----RVDFDGSSR--SRNIPPFLNSSD---------------VA
Ecym_3021          ---------FSTADI-----CVDFGEPSQ--FRKKPLVPNT-D---------------AA
TBLA0G01010        SGSCGIKPSFDVNKL-----FINGDDHSETTTVKHNSSRDASEHLFSPPPKRQILNSGIA
CAGL0L13288g       ---------ISMENI----------------SKLQSNHIDSL----------------AA
NDAI0D00860        ---------QKGPIS-----RFPG-------LGSHVPSSGVRD---------------TR
NCAS0H00870        ------------------------GSGSG--SSASPSSINV-D---------------GA
KNAG0M01140        ---------FSTSDI-----KF--------------------D---------------DG
KAFR0L00380        ---------LSTSDI-----KF--------------------D---------------VG
Smik_5.25          -------------------------------KKYHEHSFSIIR---------------SK
YEL062W            -----------------------------------------------------------P
Skud_5.27          -----------------------------------------------------------R
Suva_5.5           -----------------------------------------------------------T
ZYRO0C07876g       ---------FSTSDM-----KLGE-------GSKMHQNFSV-D---------------IA
TDEL0G04520        ---------FSTSDI-----KFGVEYERQ--RNKHHKALNL-D---------------IA
Kpol_1045.72       ---------FSTSDI-----KVGEDLISG--RNRRIQTLDL-D---------------IA
TPHA0J00310        ---------FSTSDI-----KFGVDLYTD--TKKKLHTLDV-D---------------VA
                                                                               

KLTH0C11308g       EEVLSDVYRKLALSDKKTDHVAQGNNPISKVFGRNSEDSTDISTRESANSMGSDI-----
Kwal_56.22411      EDILNDVYRKLALNENKVEQSSQSGNPMMRMFGNCSDDSSGETSVKDVVSTAGSDT----
KLLA0D01067g       DELLKSLYQKLSLKQDVPNTMSK-------FARYYDDSPSNNAFTESTSRKSSSGS----
SAKL0E01100g       EEVLKDAYKKLSIIESMDDNLYHVHNPMSRLYGHDSGESSTKGSRKGSRKGSSSTMESET
ACR009W            EEVLRETYQKLSIKDILNDSIDP-------IAKGYQAPSDNEAAMKGTSRKQSMSTLN--
Ecym_3021          DEVLRDAYKKLSLNERLPNPLDQ-------ITRSKKLSLENDASANVDNRKLSSSTSG--
TBLA0G01010        DKVLSDIHRKLAKFDDTPRSP---------IVKRKEDTFRDFSNGSNIVGYGSSNT----
CAGL0L13288g       DEALMNAYKKLSLKVPSKGAL-----------KSHNTSHSSFSLTPTAPEMENSQAKRNK
NDAI0D00860        DKLMKSFYEKLEKGKN--------------------------------------------
NCAS0H00870        DELLKNVYKKLER-----------------------------------------------
KNAG0M01140        DRLFNSLYAR--------------------------------------------------
KAFR0L00380        DRILNSIYNK--------------------------------------------------
Smik_5.25          NAVLFNNIKSGR------------------------------------------------
YEL062W            KEMTPIITKDLVNNDKLLEKRNHN-------------HLLSATGSRNTAQSGNLKPER--
Skud_5.27          KEMTRMILKDSLNDDRSLKKKNQD-------------ASFSVVGSKNSGQPNNVKSER--
Suva_5.5           KEMTPVATKEPSNEDNSLKKR--------------DYNHSLSVTGSKSTTQTNVKSER--
ZYRO0C07876g       DEVLRNVYKKLSNTNEPGSRDDY---PLSRIYREESHVSLSALSGDNVSHPKKPER----
TDEL0G04520        DEVLRNVYKKLSVTNSTDTRPNSA-DPIARLYRERSLGSLADGSTNNIYRLQNSDR----
Kpol_1045.72       DSVLKNVYKKLTLKTEEENSSNRALNSQELEKKSVQSLFESSNPYSKVPKRPGT------
TPHA0J00310        DRVLNNVYKKLSTNGRPTTSI------------------------NGQGQH---------
                   .                                                           

KLTH0C11308g       -KNKVAFDVRKT------LATSSADERRRSEILRSIEEKRNE-ELILLKSVRSVHNFDKI
Kwal_56.22411      -RNTVAFDVRRL------VNSATAEDRKKGEVMRLEEDKRKD-ELLLLKSVRDVENFDKI
KLLA0D01067g       -HQKVSFDFGTA---GQQKTVTEVPDLGDGEKVEVWKKKKEE-ELILLESLSNAETFDKV
SAKL0E01100g       -RSKVAFEKGRS----PWQVEEDEKKERTEEVSNLLKEKRHE-EFLLLKSVKSVDTFDKI
ACR009W            -TTRITFDIRNR----HVSKDNEHREQQNEDIPLLLKKKRLQ-EFLLLQSVKSVDSFDKI
Ecym_3021          -TAKVLFDMKDR------LSNKDFEYRDQNAASTELKRKRQQ-QFLLLKSIKNVDSFDKI
TBLA0G01010        -GNKVSFNLSRDSDTTQNNLDHMNPILDSSKDIIAQQQEKNHIRRLLLESLREADNMDKI
CAGL0L13288g       RLSKVSFEALPE---DRNGFRWGSNIKTPIQETTWKKLSKMQ-RRIMLKALADAETLDKI
NDAI0D00860        -HSKVSFSDKIA---FQNDENDHSATSSDNDDKSKSQLTLKQ-RNILLDSISNMDNMDKI
NCAS0H00870        -HSKVSFMDKEK-----------NESMKTDEKGRPSTMTKEE-RSVLLKSIESLENLDKI
KNAG0M01140        -FSKVSFEKRRENARERKSFDAVGGTNGADKETMI--LTKEE-KLQLLGALDNLESFDKI
KAFR0L00380        -LSKVTFDRDKK---------------LESKIGNSRNLGESE-KNILFNALERHESFDRI
Smik_5.25          -PSKVSFDMQKA-------------SSLITGESTIPKLSDDE-ERILEESVRSAENFDKI
YEL062W            -PSKVSFEMQRV-------------SSLATGKSTMPKLSDEE-EGILEESIRNAETFDKI
Skud_5.27          -PSKVSFEMQRA-------------GSLATGEATIPKLSDEE-ERILENSIRSAESFDNI
Suva_5.5           -PSKVSFEMQRA-------------NSLATGKNKIPKLSDEE-KKILEKSIRSAENFDKI
ZYRO0C07876g       -VSKVAFDMNKD-DPVPYSLSQQKGKNKEREAAKLDRAKNNQ-KIILLESIAAADCLDKI
TDEL0G04520        -PSKVSFDKQQEIGHISKGMSSSNDKVKMDEEAKLER--RER-DLILLESVEAADSLDTI
Kpol_1045.72       -LSKVSFQQNSN----MQYSASSGDVTENEDINNLEKLRKQN-EQILLEALESTENLDKI
TPHA0J00310        -PSKVAFKNQSY----DNDLPGLMNNLGIEATKFSREININD-KIYLLDALQSAENLDNI
                       : *                                       :  ::     :* :

KLTH0C11308g       CTLLGKDRERVESMLSELGPYNVLHS
Kwal_56.22411      CTRLGRDREEVEKMLEDLGPYNVVHC
KLLA0D01067g       CTKLKKSRHEVELLLKDLGHYNIVNS
SAKL0E01100g       CMRLEKDREEVEQLLKEMGHYNIINS
ACR009W            AVRLEMNKHEVERLLKGTGEYNIVNS
Ecym_3021          AIKLEINKQEVEELLKATGEYNIINS
TBLA0G01010        CIKLQKPRKEVEELLSEIGDYVIINC
CAGL0L13288g       CVLLEMPRQNVVNILHELGELKLINC
NDAI0D00860        CVKLGRPRSQIEEWLSEFGDYKVINC
NCAS0H00870        CVKLGKSRQQVERWLDELGNYKIITC
KNAG0M01140        CVQLGRSRVEIANLIADIGEYRVINC
KAFR0L00380        CSKLGKSKNEVESIISEIGEYMTINS
Smik_5.25          CVLLGKPKLEVENYLNELGEFKIINS
YEL062W            CVLLSKPKLEVESYLNELGEFKVINS
Skud_5.27          CVLLSKSKLEVENYLNELGEFKVINS
Suva_5.5           CVLLGKSKQEVENYLSELGEFKVINS
ZYRO0C07876g       CVKLEKPRHEVEELLHELGDYKIINS
TDEL0G04520        CVKLEMSRYDVEALIQNLGEYKIINS
Kpol_1045.72       CVLLEKPRSEVEEMLKHLVDFKVINS
TPHA0J00310        CSNLELSREEVETLLNELTEYRIINC
                   .  *   .  :   :        : .

FASTA FORMAT for MUSCLE Version 3.6

>KLTH0C11308g
--------------MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTI
KNYVIPKPQLCNKLLTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEP
AIERLGKMFTVLEEQSQILSKAENSSVYF--QLK------------ARNTQKHGN----T
ETAKGTEQPSSLD---------IGEIAQPENQGYASAKYYEILKDLEGPSKKIAIGDLIT
KIYRDLNDYSECLIPIDSGNAVDIKLFPLLSPPSSC-FSIEDVPISTVNLAKLIDVNWDP
TMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYYNCVILTDIFQFSNIYASTNEL
SRFLTEPTLAAECQIYVAYNESAHLPNL---PFERGPSRSGQGNIRDRSSNGTLDILRKG
KQT-PLRENSFNSGMDFLSNKHQHTPQ--SRSSSIPYHNTSDASFGNSDAGLKGKL-M--
-PFTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFITFGVLHGLIYRSYSYP
VLRNIGFAESVEALG-ATNHSRYAKYKHLLKTNQPLNNV---------------------
---------LSAADI-----RIGLENAGFKARSEKLKQHSTAD---------------AA
EEVLSDVYRKLALSDKKTDHVAQGNNPISKVFGRNSEDSTDISTRESANSMGSDI-----
-KNKVAFDVRKT------LATSSADERRRSEILRSIEEKRNE-ELILLKSVRSVHNFDKI
CTLLGKDRERVESMLSELGPYNVLHS
>Kwal_56.22411
--------------MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTI
KNYVIPKPQLCNKLLTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYES
AIARLGKMFTVLEEQSQILSKAENSHVYF--QLK------------TRDSHKHTN----Q
EPVNDNELQGTLK---------NNEASQSESHGYAFEKYHEILKDLNGPNKRISVEDLIT
KIYRDLNNYSECLIPIDSGNAVDIKLFPLLSPPSSC-LSFEDVPMPTVNLAKLIDVNWDP
TMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYYNCVILADIFQFQNIYAPTSEL
SRFLTNPALATECQIYVTLDESTHISDL---PFERKPSRTTYNNIPVRNSSSTLDVQRKG
REM-SIKESSFTAGID-QSGRNQYTPQ--SHTSSIQCHNVSDASLGNSEGGFNNKV----
-FFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFITFGVIHGLLYRCYSFP
IMKNVGYLEVVKALG-LSDGDSSTEGKWLSGNSEPTNNV---------------------
---------LSAAEI-----RIGLESSSSKLRERRFNHFSNAD---------------TA
EDILNDVYRKLALNENKVEQSSQSGNPMMRMFGNCSDDSSGETSVKDVVSTAGSDT----
-RNTVAFDVRRL------VNSATAEDRKKGEVMRLEEDKRKD-ELLLLKSVRDVENFDKI
CTRLGRDREEVEKMLEDLGPYNVVHC
>KLLA0D01067g
--------------MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTI
KNYIIPKPQLCNKLLTFKYGEYRIVCYPVNVNARYYARNSFNFNFVFVFPYDCATSPYEP
AIARLGKMFKVLEEQSQILSKSEQNPVYF--QLK------------SNDSNAAD-----Q
STEMGSITISEHT--------------DIKSTGDDGEKYLEIIKELAKNQKSLIIEDLLM
KLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSN-ISVEDVPIAVVNLSDIIDVNWDP
TMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYYNCVILSDIFQFSNIYAPTSEI
HNFLTNPAVAKACQLFVQ-GDSLKQSLL---PFEGRPN-NIYPTGRKQASTSTVHSRRRD
SN--DTATTGSTSSVR-DTHRNYLSSS--STSSYFRAHASENTSLATGENQMKR------
-ILPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITRRLIYRVNSYP
IVKNVGTWDILKSLVSKEPKTHY--------GSGSSKNI---------------------
---------FSAADI-----KVVD-------TKEEGNQSDKLD---------------AA
DELLKSLYQKLSLKQDVPNTMSK-------FARYYDDSPSNNAFTESTSRKSSSGS----
-HQKVSFDFGTA---GQQKTVTEVPDLGDGEKVEVWKKKKEE-ELILLESLSNAETFDKV
CTKLKKSRHEVELLLKDLGHYNIVNS
>SAKL0E01100g
--------------MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTI
KNYVIPKPQLCNKLLTFKYGPYRLACYPVNVNASYYARNSFNFNFVFVFPYNCATSPYEP
AVARLGKMFRVLEEQSQILSKAENDPVYF--HLK------------SQESSTNSSSHP-V
DQGGSDRPKDTEQGTGLNNSQDSKEQGKIEGQGAAIEKYHEIMDDLEKGKKRLSIEDLIT
KLYQDLNNYSECFIPIDSGNSVDIKLFPLLAPPNSC-LSFEDVPISTVNLAKLIDVNWDP
TMLKIVPFINGVNSIAKIAKFSSSDTDLVIECVKHLIYYNCVVLADIFQFSNIYASTSLI
SEFLTDPTLASECQTYVT-SSDLELYRL---PFESRPNLLSMHSSRKQNSSSTIHTVGVR
NS--PNRTNSLDYPSELSTRRNNFSSS--SASSLMRVRDRSGQSTTGSAVDEQESR-L--
-LLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDNHIDVRRFITFGIVRGLIYRCYAYP
VMKNLGALEMLKTLKSASDSRSLRRKLKFREKKNFTNNV---------------------
---------FSTADIKVDLEHSPGGAPAE--IFNRKHTSNV-D---------------MA
EEVLKDAYKKLSIIESMDDNLYHVHNPMSRLYGHDSGESSTKGSRKGSRKGSSSTMESET
-RSKVAFEKGRS----PWQVEEDEKKERTEEVSNLLKEKRHE-EFLLLKSVKSVDTFDKI
CMRLEKDREEVEQLLKEMGHYNIINS
>ACR009W
-------MPPALEKMPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTI
KNYVIPKSQLCNKLVTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEP
AIARLAKMLRVLEEQSQMLSKVERDPVYY--QLK------------TGETKAAE-----Q
KTEESDSKAKTHN-----------LDKKSRAQHNATTKYHEIMKHINSDEKNLYIEDLIT
KLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSC-LSFEDVPIAKVNLMNLVDVNWDP
TMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYYDCVALVDMFQFSNIYAPTNLL
RDFLFDFILPRECQVYVVSSEDCEIHRL---PFESRPN---GGHSRNQTASTNTVYTLRR
TTS-TNRADSFSSNAE-FSQKSSGISS--LAQSF--TQSNKDYYYNRSRNLESNCK-R--
-TLPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGVFHRLIYRCYSYP
VAKSIGTLELLKRFDYVSTTDNFIPT-----GTSAGNNV---------------------
---------FSTSDI-----RVDFDGSSR--SRNIPPFLNSSD---------------VA
EEVLRETYQKLSIKDILNDSIDP-------IAKGYQAPSDNEAAMKGTSRKQSMSTLN--
-TTRITFDIRNR----HVSKDNEHREQQNEDIPLLLKKKRLQ-EFLLLQSVKSVDSFDKI
AVRLEMNKHEVERLLKGTGEYNIVNS
>Ecym_3021
--------------MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTI
KNYVIPKPQLCNKLLTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEP
AIGRLGKMFRVLEEQSQVLSKIERDPIYY--HLK------------TQDVKAVD-----Q
NSEEPESKNNPQN---------CNDKIRRGHHEHAFEKYHEIMKHIAMNEKQLSIEDLIT
KLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSC-FSVEDVPIAKLNLIDWVDVNWDP
TMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYYDCVVLVDMFQFSNIYAPTSQL
SEFLTDPSIARECQLYVISSEDSELHQL---PFEGRPN---ANHSRNPTASTITFGTLKR
TIYTNPRPESFSSNTE-FAQKPNANTS--LPSEPSITHSSKNSEFNHENNKGILNR----
-TLPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFRKLIYRCYSYP
VAKSIGTLDMLKRFDYASLPNNFMSP-----KNNNSNNV---------------------
---------FSTADI-----CVDFGEPSQ--FRKKPLVPNT-D---------------AA
DEVLRDAYKKLSLNERLPNPLDQ-------ITRSKKLSLENDASANVDNRKLSSSTSG--
-TAKVLFDMKDR------LSNKDFEYRDQNAASTELKRKRQQ-QFLLLKSIKNVDSFDKI
AIKLEINKQEVEELLKATGEYNIINS
>TBLA0G01010
--------------MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTI
KNYIIPKPQLCHKLLTLKYGDYRLVSYPVTINSSLYARNFFSFNFVFVFPINCETSPYEP
IIARLGKMFRVLEEQNQLLSRAENDSVYF-------------------DNSHSL-----L
SSEQDSIMHQDKN-TSILGFSRKRFSFSKRPTDLSLSEYPDN-----ESGSNFSVQDLIM
RIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPPSIS-ISYEDVPVAMVDLSHVMDVNWDP
TMLKIVPFIDSINSISRIAALSNSDVDFVVECIRHLVYYQLVILSDIFQFTNIYAPTSRL
RDFLTDINLATDCQTYVCLPKNSNFGKL---PLEKSINTDLDEYSNSGSAIYPNNEILE-
----NDDRLRWPMYYK---------------------PRNSQSSLSSGISSGNERT-SN-
-YLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFGLVRGLLYRCYAIP
IMKNAGIFDILSSLTTSQSSNPYHSNGDDKNGTASTANIRFLNSITDSDIHDLKDDEINN
SGSCGIKPSFDVNKL-----FINGDDHSETTTVKHNSSRDASEHLFSPPPKRQILNSGIA
DKVLSDIHRKLAKFDDTPRSP---------IVKRKEDTFRDFSNGSNIVGYGSSNT----
-GNKVSFNLSRDSDTTQNNLDHMNPILDSSKDIIAQQQEKNHIRRLLLESLREADNMDKI
CIKLQKPRKEVEELLSEIGDYVIINC
>CAGL0L13288g
--------------MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSI
KNYVIPKRALCHRLITFKYGNYRIACYPVTVNSSIYARNFFSFNFVFVFPFNCETSPYEP
AIERLGKMFRVLEIQNQILSKSENDTIMF--NLK------------SADKNFNI-----D
NDSSNYILGDDIS------------SIMTTQQKDKYERLNNIISNIKKKPSNFTISDLLM
RLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPY-ISIEHVPISLVNLFKIVDVNWDP
IMLTIIPYINGINNIYRISQLSHNEESLVIECIRHLVYYRCIVLTDIFEFSNVYAPTSSL
RLFLLDPNMATECQSYVMLPINSKMNDLSLYPHHGKHSAFNGDIGSRNNSV---------
----STSLYSFNGNDSRPQSRSSSVDQ--SQTNFYKNKKQSESSISTGNSNNGQNI-HK-
-HLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFITFGVLRRIIYRCETYS
VINSTDHLQNLWKLNELENP----------------------------------------
---------ISMENI----------------SKLQSNHIDSL----------------AA
DEALMNAYKKLSLKVPSKGAL-----------KSHNTSHSSFSLTPTAPEMENSQAKRNK
RLSKVSFEALPE---DRNGFRWGSNIKTPIQETTWKKLSKMQ-RRIMLKALADAETLDKI
CVLLEMPRQNVVNILHELGELKLINC
>NDAI0D00860
------MHNISNLNSINHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAI
KNYIIPKKQLCNKLLTFKYANYRIVSYPITINSDFYARNFFSFNFVFVFPYDCETSPYEP
AIARLGKMFKVLEEQNQILSKAENDPIYFKSDYTPYQPTLIIPTNNDNDGKRNKKLMKKE
NTIFSTRQQRSNSNRILEENSNSNSNSNSNSNGNENDNNYNTIEQYLNNNSRISVQDLIM
RIYQDLNNYSECLIPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDP
TMLKLIPFINGINDISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLI
STFLTDPNMATLCQNYVVLPLGSKLTRL---PFHIETETSVQSSSAYRHHHNR-------
----HEKTPSFGSSIT-SNNGRSSFSA--D------DRKQSETSLNSSNDPSNSNL-IST
AHLPTKMSLFELYRSLNQRTDLKNWYKLNYTTIIENNIDIRKFIKFGIIKGLIYRCHSYP
IV----ITPVVSAPESAKSTSPFVSSSGISSSVDSKQHT---------------------
---------QKGPIS-----RFPG-------LGSHVPSSGVRD---------------TR
DKLMKSFYEKLEKGKN--------------------------------------------
-HSKVSFSDKIA---FQNDENDHSATSSDNDDKSKSQLTLKQ-RNILLDSISNMDNMDKI
CVKLGRPRSQIEEWLSEFGDYKVINC
>NCAS0H00870
-------MQNSNLNNLNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTI
KNYIIPKNQLCNRLLTFKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEP
SIARLGKMFKILEEQSQILSKAENDPIYFKSDYV------------PTEPTTTI-----I
PQISPSHRNKRNN------------DHNDNNDGSRFET--DFFGEEEDGVTKFSVQDLIM
RIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMSLINLNNVIDVNWDP
TMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITDIFQFSNVYAPTSLI
CSFLTDQEMATQCQNYVVLPIGSKLSHL---PFE--------NNGNKQPSTPK-------
----HSRTTSLSSSMS------GSVNS--HEHSYMDTIQKSETSLSLSSTDPNNPH-FEL
AHLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYP
IPQR-PSNEGIQRIERLNDIDAHRLQIRSSGSAARSNS----------------------
------------------------GSGSG--SSASPSSINV-D---------------GA
DELLKNVYKKLER-----------------------------------------------
-HSKVSFMDKEK-----------NESMKTDEKGRPSTMTKEE-RSVLLKSIESLENLDKI
CVKLGKSRQQVERWLDELGNYKIITC
>KNAG0M01140
--------------MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAI
KNYIIPKPQLCHRLLTMKYGNYRIVSYPVAVQSSSYARNYFRFNFVFVFPYECATSPYEP
AITRLGKMFRVLEEQSQVLSRAERDDSLF------------------------------K
GDKLPFDNNSAKN------------QAPLTHALISKTKSFSPDKKTEGDIHLISVQDLIM
RIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLSIEDVPMLVVKLKKIIDLNWDP
TMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYKCVIITDIFQFSNIYAPSSLI
NEFLTDPTMAYDCQEYVTLPKSSRLIHM---PLQTSVPGSRNNKHKKSNSLS--------
----STGVLSWQSNSQ-YSNNSSEFYS-------MSNKKRSESSLSSEGTPGAGRSDDHT
IYYPTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYRVLSYP
VLEKRRNSIIAKQMGKSKMAEK---------APHSKNAF---------------------
---------FSTSDI-----KF--------------------D---------------DG
DRLFNSLYAR--------------------------------------------------
-FSKVSFEKRRENARERKSFDAVGGTNGADKETMI--LTKEE-KLQLLGALDNLESFDKI
CVQLGRSRVEIANLIADIGEYRVINC
>KAFR0L00380
--------------MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSI
KNFVIPKPQLCHRLLTLEYKNYRLVSYPVNVSSSSYARNFFSFNFVFIFSYDCQTLPYEP
AIERLGKMFKTLEEQSQILSKSQRTSAFF-------------------------------
----------------------------------------KDGEDVDFVDTKFSIQDLLM
RLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIEDVPLSIVNLDKIVDLNWDP
TMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNCVIITDIFQFSNIYAPSSLI
NNFLRDPMIAFNCQSYVVLPPGSKINDL---PLASEQDDEINNSDMTQKAL---------
----SSSRSSFSSYFS------HKSAY--ARVSETAHHHQSTSTLSSSEGQQDNPR-QGQ
-VLPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIYRVHQYP
IMEHKTFKSPLLS------------------DRQNDKIV---------------------
---------LSTSDI-----KF--------------------D---------------VG
DRILNSIYNK--------------------------------------------------
-LSKVTFDRDKK---------------LESKIGNSRNLGESE-KNILFNALERHESFDRI
CSKLGKSKNEVESIISEIGEYMTINS
>Smik_5.25
--------------MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTI
KNYIIPKPVLCHKLITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEP
AITRLGKMFKVLEEQNQLLSKSEKDPVFF--DLK------------ALENSTIA-----P
STACPPATSNTSSNTTPTHPTSDKDAKDLRNS-----RYNDLVKDFELPESTFSIQDLLM
RIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTC-VSLEDVPLSSVNLEKIIDVNWDP
TMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSSI
RNFLTDPLMANDCQYYVTFPEVSKISSL---PLNKNLTSGDLDSPSFSVRRKSKSSSIPS
NP--GSRTTSFSSTSK--VSQNSSINS--SFSSAYRDWRQSQTSCSSSNIHISNNR-NR-
-FLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLEKRIIYRSYSYP
VMLSVGPRETKETAPIIAKDSP---------NESNSSE----------------------
-------------------------------KKYHEHSFSIIR---------------SK
NAVLFNNIKSGR------------------------------------------------
-PSKVSFDMQKA-------------SSLITGESTIPKLSDDE-ERILEESVRSAENFDKI
CVLLGKPKLEVENYLNELGEFKIINS
>YEL062W
--------------MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTF
KNYIIPKPILCHKLITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEP
AITRLGKMFKVLEEQNQLLSKSERDPVFF--DLK------------VLENSTTT-----P
STAGPSSTPNPSSNTTPTHPTSEKDTKDMRSS-----RYSDLIKDLGLPQSAFSIQDLLM
RIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTC-VSLEDVPLSSVNLKKIIDVNWDP
TMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLI
RNFLTDPLMASDCQSYVTFPEVSKISNL---PLNKSLGSGDQDSPSFSVRRKSKSSSIPS
NP--DSRTTSFSSTSR--VSQNSSLNS--SFSSIYKDWRQSQTSCSSSNIHVINNR-NR-
-FLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLEKRIIYRCYSFP
VMINAGSRE---------------------------------------------------
-----------------------------------------------------------P
KEMTPIITKDLVNNDKLLEKRNHN-------------HLLSATGSRNTAQSGNLKPER--
-PSKVSFEMQRV-------------SSLATGKSTMPKLSDEE-EGILEESIRNAETFDKI
CVLLSKPKLEVESYLNELGEFKVINS
>Skud_5.27
--------------MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTI
KNYIIPKPILCHKLITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEP
AITRLGKMFKVLEEQNQLLSKSEKDAVFF--DLK------------ALENSTIT-----P
STAGAPTTSNPSSNTTPTYPTSDKDAKDLRSS-----RYNDLTKDLGLPESSFSIQDLLM
RIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTC-VSLEDVPLSSVNLKKIIDVNWDP
TMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLI
RTFLTDQLMASDCQSYVAFPEISKMSSL---PLSKNLDSADRDSPSLFVRRKSKSSSIPS
NP--DSRTTSFSSNSK--VSQNSSLNS--SFSSVCKDWRQSQTSLSSSNLRANDNR-NR-
-FLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGLERRIIYRCYSFP
VMLNVDSRE---------------------------------------------------
-----------------------------------------------------------R
KEMTRMILKDSLNDDRSLKKKNQD-------------ASFSVVGSKNSGQPNNVKSER--
-PSKVSFEMQRA-------------GSLATGEATIPKLSDEE-ERILENSIRSAESFDNI
CVLLSKSKLEVENYLNELGEFKVINS
>Suva_5.5
--------------MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTI
KNYIIPKPILCHKLITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEP
AITRLGKMFKVLEEQNQLLSKSERDPVFF--DLK------------AIENSLLT-----P
STAGPPATSNPSSNTTPTHPTSDKDAKDLRSNRFNGEKYNDIIKDLGLPESTFSIQDLLM
RIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPPTTC-VSLEDVPLSSVNLKKIIDVNWDP
TMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSLI
RNFLTDPLMATDCQSYVTFPEISKLSNL---PLNKNFDSVDQDLTSFSVRRKSKSSSVPS
NP--NSRTTSFSSTSK--VSQNSSLNS--SFSSVSKDWRQSQTSCSSTNTHAISKR-NQ-
-FLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFITFGLERSIIYRCYSFP
VMIHVGSRD---------------------------------------------------
-----------------------------------------------------------T
KEMTPVATKEPSNEDNSLKKR--------------DYNHSLSVTGSKSTTQTNVKSER--
-PSKVSFEMQRA-------------NSLATGKNKIPKLSDEE-KKILEKSIRSAENFDKI
CVLLGKSKQEVENYLSELGEFKVINS
>ZYRO0C07876g
MSLRYIQACANTGRMTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAI
KNYIIPKPQLCHKLLTLKYKGYRIVCYPVTVNSPYYARNFFSFNFVFVFPYDCETSSYEP
AIARLGKMFRVLEEQNQILSKAENDPIYF--DFK------------LADNTTEQ-----D
GKLNAEKSFKGLT----------------KSQGMALAKYNEIMKDLESEKSDFSVQDLVM
RIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNSC-ISIEDVPISTVNLKTIIDVNWDP
TMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYYNCVILADIFQFSNIYAPTSLI
RQFLTDPTLASECQSHVTLAGHSSLSEM---PFERLRKFDLDDMDQSKNQES--------
----GSRTTSMSSKSD-SKSKRPFFYS--APRNPYRFNQRSQSSFSSTNTNVTHDL-AR-
-HLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGLIYRCFSFP
VMKKMSIFDLAHKLHTAGNLNQVTKKGKGQKNLAESKYV---------------------
---------FSTSDM-----KLGE-------GSKMHQNFSV-D---------------IA
DEVLRNVYKKLSNTNEPGSRDDY---PLSRIYREESHVSLSALSGDNVSHPKKPER----
-VSKVAFDMNKD-DPVPYSLSQQKGKNKEREAAKLDRAKNNQ-KIILLESIAAADCLDKI
CVKLEKPRHEVEELLHELGDYKIINS
>TDEL0G04520
--------------MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAI
KNYIIPKPQLCHKLLTLKYKNYRIASYPVTVNSPIYARNFFSFNFVFVFPYDCQTSPYEP
AIARLGKMFKVLEEQNLILSKAEKDPIFY--HFK------------QVEIKDDQ-----D
AKSKPEKGSHNLS----------------KSQAYASEKYHKIMTDIESADSTFSLKDLVL
RVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNSN-ISIEDVPVSTVNLNKVIDVNWDP
TMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNCVLLADIFQFSNIYAPTSSL
RTFLTDSVLSTECQSYVVCEEDSTLPRL---PFKRVNHSATESVDHELADSHRSQRTS--
----GSRTTSMSSNGKFFPSSNNEMPALISEESLYRTGKHSQSSFSSNNTNPSNML-AR-
-YLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVINGLIYRCYSYP
IMKNLEIFDLAKRLHREDISNHTVKHNK---AKNPSKNI---------------------
---------FSTSDI-----KFGVEYERQ--RNKHHKALNL-D---------------IA
DEVLRNVYKKLSVTNSTDTRPNSA-DPIARLYRERSLGSLADGSTNNIYRLQNSDR----
-PSKVSFDKQQEIGHISKGMSSSNDKVKMDEEAKLER--RER-DLILLESVEAADSLDTI
CVKLEMSRYDVEALIQNLGEYKIINS
>Kpol_1045.72
---------------MVGFDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSI
RSYVIPKPQLCNKLLTLKYGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYES
VIVKLGKMFRVLEEQSQFLSKAEKDLAYF--DFK-----------AILHSSLDQDSKLKP
EKDSSGNNNGNSNNSNNDQSNSANATDSKKNSSYLFEKYKEIQEFVSNDESDFSIQDFIM
RLYQDLNNYSECLIPIDAGNAVDIKLFPLLRPPPAT-ISIEDVPISRVNLKEIIDVNWDP
TMLKIVPHIDGVNSIAKIAKLSDSDTVLVIECIKHFIYYGCVVISDIFQFSNIYAPTSLL
RNFLTDPLMATECQTYVTVPESSTLHQL---PLESLSKLKLDSDGSDSQNLRKSKNGI--
----DSRAASFVSSRGASSHNENSSLY--SRSDLYLNRHRSESSISSQNTNDLNGN-VK-
-QLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNGIDIRKFIIFGIINGLLYRCQSFP
VTANFEEINKVKKFKDIQNRKETRKDKL---QKQLSQDI---------------------
---------FSTSDI-----KVGEDLISG--RNRRIQTLDL-D---------------IA
DSVLKNVYKKLTLKTEEENSSNRALNSQELEKKSVQSLFESSNPYSKVPKRPGT------
-LSKVSFQQNSN----MQYSASSGDVTENEDINNLEKLRKQN-EQILLEALESTENLDKI
CVLLEKPRSEVEEMLKHLVDFKVINS
>TPHA0J00310
--------------MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAI
KNYVIPKPQLCHKLLTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEP
VVERLGKMFCELEGQCQFLSKCEKDMAYF--DFK------LISNLIDQDKSNTEPDNNIL
SKTNSMILPTISNIDTTVGSTNTQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILM
RVFQDLNSYSECYIPIDDGNAIDIKLFPTLMPPIDS-ISVEDVPIPTVNLNKIIDVNWDP
TMLKIVPYIDGLNSIFKIANLSNSDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSI
TDFLTDPTLATECQIYVTSPEDSLLSAL---PFKKGRKMVKNRRSASIASHFTSSSSLRQ
NL--NSKASSFISDEG--HHNDDTAYP--NHDSIYENRRRSESSFSSGNNDEMHQN-RN-
-YLPTKSTLFDLYRSLSQGVKLEEWYQINFNSIRDNFIDIRRFIIFGIIKRIIYRCHSYP
LPKNYEAFSKLNDLKNLQNGPKIVKNK----SQSYTYNI---------------------
---------FSTSDI-----KFGVDLYTD--TKKKLHTLDV-D---------------VA
DRVLNNVYKKLSTNGRPTTSI------------------------NGQGQH---------
-PSKVAFKNQSY----DNDLPGLMNNLGIEATKFSREININD-KIYLLDALQSAENLDNI
CSNLELSREEVETLLNELTEYRIINC