MUSCLE (3.8) multiple sequence alignment

KNAG0C00780        --MTSAQDEGLL--RDPPP--------------------SYELHEL--------------
YEL064C            --MSELGEYSKL--ENKELRT------------------EFELTNF---PFPGTTD----
Smik_5.23          --MAELGAYTKL--ENKELRT------------------EFELTDF---PLPGITD----
Skud_5.25          --MTEVGGYTKL--ENKELRT------------------EFELTDF---PLLGITD----
Suva_5.3           --MSELGEYSKL--ENKELRT------------------EFELTNF---PLSGITD----
NDAI0I00130        ------MNYTIV--PTDE---------------------EFQLQD---------------
NCAS0J01840        ------MSYSMI--PLDE---------------------ESQLPDT--------------
ZYRO0F16720g       --MSGGRGYEPL--TGSDQLG-------------TRSDPEFELSHFTSQNNSSKKDSHNS
TDEL0C06210        --MPKNDGYSRL--EEQSE-R-------------IPLELEFELVDF--DAKPGASD----
AFR671W            -MSVPNIQYSRLDGDETGKEG-------------TSVQSPFHTVQLNREWGDPSSS----
KLLA0C02277g       MQIAADKKYAKLALSDKQSKN-------------EPNPFELELTSF---------D----
Ecym_1084          MKGTSKQPYKKLDSSEPEPAACTSKSTRHSSPIPVSSDLQFELSTF--------------
SAKL0C02574g       MPPSISQPYAPV------------------------ADLQFELSSFDQHMQPAHAS----
KLTH0F02332g       -MSKDPFNEPFIQGRGSHDQR-------------GPLGDNFELSSF--------------
Kwal_33.13386      -MSKEAANEASIQEETFSDRD-------------ELLGSSFQLSSF--------------
                              :                                                

KNAG0C00780        ------------------------------ENPLIAGIIETNEEKSPLHMAFMNMANSI-
YEL064C            -----NDSDDGSQGQNSLNIITPDM-----DDTLVNDVLRENDKKSSMRMAFMNLANSI-
Smik_5.23          -----NNSDDRSQGKDSLKAIYPIASDT--DDTLVNKVLLENDKKSSMRMAFMNLANSI-
Skud_5.25          -----NDSDDGSQGKDSPNFVYPITSDT--DDPLVNSVLRENDKKSSMRMAFMNLANSI-
Suva_5.3           -----NDSDDGSQGKDFPNTIYPIISDT--DDQLVNNVLRENDKKSSMRMAFMNLANSI-
NDAI0I00130        ------------------------------SEALVKEIIDENNKKSNIYMAFVNMANSI-
NCAS0J01840        ------------------------------SEELAKELIEENEKKSNVYMAFMNMANSI-
ZYRO0F16720g       LEGEEEEPEDREGTNDTTNLEYGIDDNYDNDDEFVNDVIRENNKKSTMKWAFMNMANSI-
TDEL0C06210        -----ETEENDSNEAKASSSNSAI------DESMVINLLRDNDKKSTMRWAFMNMANSI-
AFR671W            ---NGDRIELIDYPTKSSTLSSGFDLE---EDSVLGAIVQESKGKVQYVYGLHEHGEQVS
KLLA0C02277g       -----DTAKTADSAVDQNIFNVNE------EDPLTDDIYLSNEAKSNRYMAFMNMANSI-
Ecym_1084          --HDYELLPTTSGARNNKNVQNNVELNLQFEDPNVSQLTNPNRGKSNMYMAFMNMANSI-
SAKL0C02574g       -----GSAADEDDETKFVDTGADV------EDPLVSGIVTENQTKSNIYMAFMNMANSI-
KLTH0F02332g       ---------DRSTEVRPERLSVDS------EDRFTSTFLHEQRSKSNILMAFMNMANSI-
Kwal_33.13386      ---------DRNSQRNSERLIDGS------EDESTTAFLRENRSKSNIFMAFMNMANSI-
                                                 .:     .   .  *     .: : .:.: 

KNAG0C00780        LGAGIISQPFAVREAGVLGAFVVYIALGFLVDWTLRLIVQNLVITGTETYQESVAVALGE
YEL064C            LGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLAGKRTYQGTVEHVMGK
Smik_5.23          LGAGIITQPFAIKNAGILGGLISYIALGFIVDWTLRLIVINLTLAGKRTYQGTVEHVMGK
Skud_5.25          LGAGIITQPVAIKNAGILGGLIAYIALGFIVDWTLRLIVINLTLAGKRTYQGTVEHVMGK
Suva_5.3           LGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLAGKRTYQGTVEYVMGK
NDAI0I00130        LGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGR
NCAS0J01840        LGAGIITQPLAVKNAGILGSIICYILLGFIVDWTLRLLVINITLSSKQTYQDTVEHVMGK
ZYRO0F16720g       LGAGVIGQPIAIKNSGIVGAIIAYLVLFVLVDWTLRLIVINLTLAGKKTYQDTVAFAMGK
TDEL0C06210        LGAGVVGQPFAIRNCGIIGGILAYIILVLLVDWTLRLIVINLTLAGKKTYQDTVEFALGR
AFR671W            LELVWSGSRLRLKNCGLLGGLVLTMLLTVIVDWTIRLIIINLKLTGKTTYQDTVEFAMGR
KLLA0C02277g       LGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLIVINLKLTGKSTYQASVETAMGQ
Ecym_1084          LGAGVIGQPFAIKNCGLIGGVCLIVLLTIIVDWTIRLIVINLKLTGKTTYQDSVEFAMGT
SAKL0C02574g       LGAGIIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVVNLKLTGKTTYQDSVEFAMGR
KLTH0F02332g       LGAGIIGQPFAVKNCGLLGGVLAIVLLSLLVDWTIRLIVVNLRISGKTTYQDSVELAMGR
Kwal_33.13386      LGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQDSVEFAMGR
                   *      . . :.:.*: ...   : : .:****:**:: *: ::.. **  :*  .:* 

KNAG0C00780        PGRLAILLANGLFAFGGCVAFCIIIGDTIPHVLRTVCPPQ------YIERNWVIIVVTLL
YEL064C            KGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVLRAIFSQNDGNVHFWLRRNVIIVMVTTF
Smik_5.23          KGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVLRAIFSQKDGDIHFWLRRNVIIIIVTIF
Skud_5.25          KGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVLRAVFSQNDGEVHFWLRRNVIIVLVTIF
Suva_5.3           KGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVLRAVFSQNDGEVHFWLRRNVIIIMVTIF
NDAI0I00130        KGKYLILCCNGLFALGGCIGFCIIIGDTIPHVLRIFIHSH------FVTRNSVIFFSTLF
NCAS0J01840        KGKFLILGCNGLFALGGCIGFSIIIGDTIPHVLRIFFNSE------KITRNMVIFLTTLF
ZYRO0F16720g       RGRIAVLTANGLFAFGGCIGFCIIIGDTLPHVFRAFIHQNS----VFLSRRLIITIVTIC
TDEL0C06210        KGRILVLLSNGLFAFGGCIGFCIIIGDTIPHFLQSIFHSSN----FFFRRNVVITIVTLF
AFR671W            PGKYAVLFANGMFAFGGCVGFCIIIGDSIPHVLRAFFPNYI----EYFNRNMIITIVTIF
KLLA0C02277g       WGGLLILVSNGLFAFGGCVGFCIIIGDSIPHVLSAFFPSHT----DLFHRNVIITLVTLF
Ecym_1084          KGKLLILFVNGLFAFGGCVGFCIIIGDSIPHVLKAFFPSHS----ELFRRNVVISVVTLF
SAKL0C02574g       RGKLLILAANGLFAFGGCIGFCIIIGDTIPHVLRAFFPAHT----ALFHRNAIIFFVTLF
KLTH0F02332g       KGKLLILLSNGLFAFGGCIGFCIIIGDTIPHVLRAFFSGHD----NLFHRNIVIVVVTCL
Kwal_33.13386      KGKLLILLSNGLFAFGGCVGFCIIIGDTIPHVLRAFFPGHE----NLFHRNIIIILVTCF
                    *   :*  **:**:***:.:.*****::**.:  .           . *. :* . *  

KNAG0C00780        ISLPLSLSKKIKQLERASFLALVSMAVIVVTVAVRGPFLPSELKSQVSLFAPQWWFRKTI
YEL064C            ISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLPYDWKGH-SLKLSDFFMKATI
Smik_5.23          ISFPLSLKRNIEALSKASFLAVISMIIIVVTVVIRGPMLPYDWKGH-SLQLRDFFVKTTI
Skud_5.25          ISFPLSLKRNIEGLSKASFLAVISMIIIVLTVVIRGPMLPYDWKGH-SLKWPDFLVKTTI
Suva_5.3           ISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGPMLPYDWRGH-TLKLSDIFIKTTI
NDAI0I00130        ISYPLSLLRDISALSSTSFLALISMTVIVMTVVVFGPSLPAELKGS-GIPSSSYVASPSL
NCAS0J01840        ISYPLSLLRNIAALSKASFLALVSMVVIVFTVVIRGPALPSELKGE-PLSHSSLFFSPSL
ZYRO0F16720g       ISYPLALQRNIAALSKASFLALISMVIIVFTVIIRGPEIHAKRD---PLTWEDILVTPRI
TDEL0C06210        ISYPLSLQRNIAALSKASFLALISMVVIVFSVVVQGPRVDMSLKGD-KWSLTDIFISSAI
AFR671W            VSYPLSLNRNISKLSKASMLALVSLLLIVVIIVVRGPTVGNDYRG--SFDLEELFVKPRL
KLLA0C02277g       ISFPLSLNRDISKLSKTSMLALLGLIAIVIIIVVKAPLVSGEYKG--TFHLHQLFITPRI
Ecym_1084          ISYPLSLNRNISKLSKASMLALVSLLLIVALVIIRAPKVEDEYKG--QFTWEEAFITPRV
SAKL0C02574g       VSYPLSLNRDISKLSKASMLALASMLLIVVIVIVKGPMLDAAYKG--SLTASKLFITPRI
KLTH0F02332g       ISFPLSLNRDISKLSKASMLALASMVVIVVIVVIKGPGTDSAYKG--SFNSSNLLITPRI
Kwal_33.13386      ISFPLSLNRNISKLSKASMLALVSMVFIVVIVLVKGPMIDDAYKG--SFNTTELFFTPRI
                   :* **:: ..*  *. :*:**: .:  **  : : .*               .      :

KNAG0C00780        FKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLMGYTGFHTFKE
YEL064C            FRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISVICCALMGYSGFAVFKE
Smik_5.23          FRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISVICCGLMGYSGFAAFKE
Skud_5.25          FRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISVICCGLMGFSGFAAFKE
Suva_5.3           FRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHISIVISVICCGLMGYSGFAAFKE
NDAI0I00130        FRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTG
NCAS0J01840        FKSLSIISFALVCHHNTSFIFHSIRNKSLTKFTKLTHISVFISVAFCMLMGYSGFFIFTD
ZYRO0F16720g       FRGISVISFALVCHHNTSFIYFSIKNRSLRKFNRLTHISTSISVVFCMIMGFSGFAAFGQ
TDEL0C06210        FRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISMIFCMLMGYSGYSVFRD
AFR671W            FQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKS
KLLA0C02277g       FQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKD
Ecym_1084          FQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFKD
SAKL0C02574g       FQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKD
KLTH0F02332g       FQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKD
Kwal_33.13386      FQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGYTGFLVFKD
                   *..:*::****** ******:.*:.. *: .*  *** *  ::   *   .: *:  *  

KNAG0C00780        KTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLEIFVLRNVVLDIWAGPTHRWYQHRRH
YEL064C            KTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLRDVVGNLLH------------
Smik_5.23          KTKGNILNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLRDVVGNLLH------------
Skud_5.25          KTKGNVLNNFPGTDTAINVARLCFGFNMLTTFPMEIFVLRDVVGNSLH------------
Suva_5.3           KTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFVLRDVVGNLLH------------
NDAI0I00130        KTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRDVIAVILL------------
NCAS0J01840        KTKGNILNNFPAKDNIINIARICFGFNMLTTFPLEIFVLRDVVAVILL------------
ZYRO0F16720g       NTKGNVLNNFSADDKAVNIARLCFGFNMLTTFPLEIFVLRDVIASFIG------------
TDEL0C06210        KTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRDVIAAFLY------------
AFR671W            KTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLIS------------
KLLA0C02277g       KTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIY------------
Ecym_1084          KTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVLRDVVRDLLY------------
SAKL0C02574g       KTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAH------------
KLTH0F02332g       KTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMF------------
Kwal_33.13386      RTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMF------------
                   .* **:**.*.  .  :*.**. :*******:*:*:****:*:                 

KNAG0C00780        HPPRGGHTATQQPPPPEPHGSSPARGPAGPHPGLPPDPEPSEQPHTAVTVVLVLATMGVA
YEL064C            ----ECNLIKNYDEHTQ----------------------LSGKQHVVITSSLVFITMGIS
Smik_5.23          ----ECKIIKNYDEHTQ----------------------LSGKQHIVITSLLVFITMGIS
Skud_5.25          ----ECHLIKSYDEHTQ----------------------LSDKQHTIITSLLVFITMSIS
Suva_5.3           ----ECHLIKNYDEHTQ----------------------LSNKQHTIITSMLVFITMGIS
NDAI0I00130        ----ENEWIPSIEEKPGM-------------------PILTRKWHFIVTTIIVFLTMSVS
NCAS0J01840        ----ECHLVPSEENNPLL-------------------PYLSRKWHFCITTGLVFLSMGIS
ZYRO0F16720g       ----------GHQPNGDP-------------------NVLSKSNHFIITTILVFGTMSIS
TDEL0C06210        ----G----KKEEDETEA-------------------PPLSTRKLFIITTVCVVSTMSIS
AFR671W            ----------TETPKGEP-------------------LRLSTKRHFIITTALVLSTMGIS
KLLA0C02277g       ----------YNKDDPEP-------------------VKLTTKMHALITSGLVLIIMCIA
Ecym_1084          ----------FQSADSES-------------------IILTTKEHFIVTSVLVFISMSIS
SAKL0C02574g       ---------FHSGEATAP-------------------AELSTKKHVAVTSALVFLTMTVS
KLTH0F02332g       ---------FNSEPKSQP-------------------RVLSLKLHVIISTALVFGTMAIS
Kwal_33.13386      ---------FNSKDTNQS-------------------QELSLKLHVILTTILVMTTMLIS
                                                           :      ::   *.  * ::

KNAG0C00780        LVTCNLGALLEVIGSTTGALTAYILPPLTHVLLTRRRPQPHTARERLGHCCCVVFGCTVM
YEL064C            LTTCNLGALFELIGATTASTMAYILPPYTNLLLTSKK-K--SWKERLPFYLCICFGFMIM
Smik_5.23          LTTCNLGALFELIGATTASTMAYILPPYTNLLLTSKK-K--SWSAKLPFYLCICFGFMIM
Skud_5.25          LTTCNLGALFELIGSTTASTMAYILPPYTNLLLTSKK-K--NWKAKLPYYLCICFGFMIM
Suva_5.3           LTTCNLGALFELIGATTASTMAYILPPYTNLLLTSKK-K--NWKAKLPYYFCICFGFMIM
NDAI0I00130        LLTCNLGALFELVGATTASVMAYILPPYVNLLLRQEK-EPLPIKSKIPHYFCILFGFTVM
NCAS0J01840        LMTCNLGALFELIGSTTASVMAYILPPYVNLLLRQQR-NELSFTTKLPHYFCIFFGFTVM
ZYRO0F16720g       LLTCNLGAIFELIGATTASMMAYILPPWVNLLLTSDK----TFRQKLPHFACIAFGFSIM
TDEL0C06210        LTTCNLGALFELIGATTASTMAYILPPYTNLVLSKEA-N--TFRQKVPHYLCIFFGFMVM
AFR671W            LTTCNLGALLELVGSTTASLSAYILPPMTNLILTGER-R--AAKEKLPHYACILFGFSIM
KLLA0C02277g       LSTSNLGALLEIIGATSASLMAYILPPLTNLVITGKK-K--SLKEKLPYCGCIVFGVILM
Ecym_1084          LTTCNLGALLELVGSTTASLTAYILPPATTLALTGKT-K--TLKERTPYYACIMFGFSIM
SAKL0C02574g       LTTCNLGALFELIGATTASMMAYILPPLTNLLLTGRA-K--TLRQKLPYYGCIVFGFAVM
KLTH0F02332g       LTTCNLGALFELIGATTASLMAYILPPWVNLKLVGGN-L--KWRDRIPHYVCIGFGFAIM
Kwal_33.13386      LTTCNLGALFELTGATTASLMAYILPPSVNLLLIGKR-S--TVREKLPHYACIIFGFTIM
                   * *.****::*: *:*:.:  ****** . : :            .  .  *: **  :*

KNAG0C00780        LVSTTQTLLDWSRSAGRGGRPLRVLSRRAVPARPRPPCAPPNLDYRFR
YEL064C            IISSTQTIID------------------AVNGSDGQHCQI--------
Smik_5.23          IISSTQTILD------------------AVNGSDGQHCQI--------
Skud_5.25          IVSSTQTILD------------------AINGADEQHCEI--------
Suva_5.3           IVSSTQTILD------------------AVNGPDGQHCQI--------
NDAI0I00130        IVSSFQTIVE------------------ALADNEQKHCEI--------
NCAS0J01840        IISSTETILD------------------AVFGTEQKHCEI--------
ZYRO0F16720g       LISSIQTILD------------------TMNGTDEKQCEL--------
TDEL0C06210        IVSSTQTIIE------------------VVKGSDQRHCEL--------
AFR671W            VISSTQAIIT------------------AIHSDKSSQCDA--------
KLLA0C02277g       FVSTAQTILE------------------AFA-----------------
Ecym_1084          IVSSTQTILS------------------AIYGTEIKHCEA--------
SAKL0C02574g       VISSTQTILA------------------AINGGEQKHCET--------
KLTH0F02332g       LISSTQTIIS------------------YINGGDQKHCET--------
Kwal_33.13386      VVSSSQTIIA------------------YIRGGDQKHCEV--------
                   .:*: ::::                    .                  

FASTA FORMAT for MUSCLE Version 3.6

>KNAG0C00780
--MTSAQDEGLL--RDPPP--------------------SYELHEL--------------
------------------------------ENPLIAGIIETNEEKSPLHMAFMNMANSI-
LGAGIISQPFAVREAGVLGAFVVYIALGFLVDWTLRLIVQNLVITGTETYQESVAVALGE
PGRLAILLANGLFAFGGCVAFCIIIGDTIPHVLRTVCPPQ------YIERNWVIIVVTLL
ISLPLSLSKKIKQLERASFLALVSMAVIVVTVAVRGPFLPSELKSQVSLFAPQWWFRKTI
FKSVSIVSFALVCHHNTSFIFHSLRNKSIYKFNRLTHWSCAVSVSVCMLMGYTGFHTFKE
KTKGNVLNNFSGDDGWINVARLFFGFNMLTTFPLEIFVLRNVVLDIWAGPTHRWYQHRRH
HPPRGGHTATQQPPPPEPHGSSPARGPAGPHPGLPPDPEPSEQPHTAVTVVLVLATMGVA
LVTCNLGALLEVIGSTTGALTAYILPPLTHVLLTRRRPQPHTARERLGHCCCVVFGCTVM
LVSTTQTLLDWSRSAGRGGRPLRVLSRRAVPARPRPPCAPPNLDYRFR
>YEL064C
--MSELGEYSKL--ENKELRT------------------EFELTNF---PFPGTTD----
-----NDSDDGSQGQNSLNIITPDM-----DDTLVNDVLRENDKKSSMRMAFMNLANSI-
LGAGIITQPFAIKNAGILGGLLSYVALGFIVDWTLRLIVINLTLAGKRTYQGTVEHVMGK
KGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVLRAIFSQNDGNVHFWLRRNVIIVMVTTF
ISFPLSMKRNIEALSKASFLAVISMIIIVLTVVIRGPMLPYDWKGH-SLKLSDFFMKATI
FRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISVICCALMGYSGFAVFKE
KTKGNVLNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLRDVVGNLLH------------
----ECNLIKNYDEHTQ----------------------LSGKQHVVITSSLVFITMGIS
LTTCNLGALFELIGATTASTMAYILPPYTNLLLTSKK-K--SWKERLPFYLCICFGFMIM
IISSTQTIID------------------AVNGSDGQHCQI--------
>Smik_5.23
--MAELGAYTKL--ENKELRT------------------EFELTDF---PLPGITD----
-----NNSDDRSQGKDSLKAIYPIASDT--DDTLVNKVLLENDKKSSMRMAFMNLANSI-
LGAGIITQPFAIKNAGILGGLISYIALGFIVDWTLRLIVINLTLAGKRTYQGTVEHVMGK
KGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVLRAIFSQKDGDIHFWLRRNVIIIIVTIF
ISFPLSLKRNIEALSKASFLAVISMIIIVVTVVIRGPMLPYDWKGH-SLQLRDFFVKTTI
FRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISVICCGLMGYSGFAAFKE
KTKGNILNSFPGTDTAINIARLCFGFNMLTTFPMEIFVLRDVVGNLLH------------
----ECKIIKNYDEHTQ----------------------LSGKQHIVITSLLVFITMGIS
LTTCNLGALFELIGATTASTMAYILPPYTNLLLTSKK-K--SWSAKLPFYLCICFGFMIM
IISSTQTILD------------------AVNGSDGQHCQI--------
>Skud_5.25
--MTEVGGYTKL--ENKELRT------------------EFELTDF---PLLGITD----
-----NDSDDGSQGKDSPNFVYPITSDT--DDPLVNSVLRENDKKSSMRMAFMNLANSI-
LGAGIITQPVAIKNAGILGGLIAYIALGFIVDWTLRLIVINLTLAGKRTYQGTVEHVMGK
KGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVLRAVFSQNDGEVHFWLRRNVIIVLVTIF
ISFPLSLKRNIEGLSKASFLAVISMIIIVLTVVIRGPMLPYDWKGH-SLKWPDFLVKTTI
FRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTRLTHISIIISVICCGLMGFSGFAAFKE
KTKGNVLNNFPGTDTAINVARLCFGFNMLTTFPMEIFVLRDVVGNSLH------------
----ECHLIKSYDEHTQ----------------------LSDKQHTIITSLLVFITMSIS
LTTCNLGALFELIGSTTASTMAYILPPYTNLLLTSKK-K--NWKAKLPYYLCICFGFMIM
IVSSTQTILD------------------AINGADEQHCEI--------
>Suva_5.3
--MSELGEYSKL--ENKELRT------------------EFELTNF---PLSGITD----
-----NDSDDGSQGKDFPNTIYPIISDT--DDQLVNNVLRENDKKSSMRMAFMNLANSI-
LGAGIITQPFAIKNAGIIGGLISYIALGFIVDWTLRLIVINLTLAGKRTYQGTVEYVMGK
KGKLLILFTNGLFAFGGCIGYCIIIGDTIPHVLRAVFSQNDGEVHFWLRRNVIIIMVTIF
ISFPLSLKRNIEGLSKASFLAVLSMIVIVLTVVIRGPMLPYDWRGH-TLKLSDIFIKTTI
FRSLSVISFALVCHHNTSFIFFSMRNRSVAKFTKLTHISIVISVICCGLMGYSGFAAFKE
KTKGNVLNSFPGTDTAINVARLCFGFNMLTTFPMEIFVLRDVVGNLLH------------
----ECHLIKNYDEHTQ----------------------LSNKQHTIITSMLVFITMGIS
LTTCNLGALFELIGATTASTMAYILPPYTNLLLTSKK-K--NWKAKLPYYFCICFGFMIM
IVSSTQTILD------------------AVNGPDGQHCQI--------
>NDAI0I00130
------MNYTIV--PTDE---------------------EFQLQD---------------
------------------------------SEALVKEIIDENNKKSNIYMAFVNMANSI-
LGAGIITQPLAVKNAGLCASIVIYIMLGFIVDWTLRLLITNITLSSKLTYGDTVEYTMGR
KGKYLILCCNGLFALGGCIGFCIIIGDTIPHVLRIFIHSH------FVTRNSVIFFSTLF
ISYPLSLLRDISALSSTSFLALISMTVIVMTVVVFGPSLPAELKGS-GIPSSSYVASPSL
FRSLSIVSFALVCHHNTSFIFHSIRNKSLTKFTKLTHLSVFISVIFCMIMGYAGFFIFTG
KTKGNILNNFPPNGVAINIARVCFGFNMLTTLPLELFVLRDVIAVILL------------
----ENEWIPSIEEKPGM-------------------PILTRKWHFIVTTIIVFLTMSVS
LLTCNLGALFELVGATTASVMAYILPPYVNLLLRQEK-EPLPIKSKIPHYFCILFGFTVM
IVSSFQTIVE------------------ALADNEQKHCEI--------
>NCAS0J01840
------MSYSMI--PLDE---------------------ESQLPDT--------------
------------------------------SEELAKELIEENEKKSNVYMAFMNMANSI-
LGAGIITQPLAVKNAGILGSIICYILLGFIVDWTLRLLVINITLSSKQTYQDTVEHVMGK
KGKFLILGCNGLFALGGCIGFSIIIGDTIPHVLRIFFNSE------KITRNMVIFLTTLF
ISYPLSLLRNIAALSKASFLALVSMVVIVFTVVIRGPALPSELKGE-PLSHSSLFFSPSL
FKSLSIISFALVCHHNTSFIFHSIRNKSLTKFTKLTHISVFISVAFCMLMGYSGFFIFTD
KTKGNILNNFPAKDNIINIARICFGFNMLTTFPLEIFVLRDVVAVILL------------
----ECHLVPSEENNPLL-------------------PYLSRKWHFCITTGLVFLSMGIS
LMTCNLGALFELIGSTTASVMAYILPPYVNLLLRQQR-NELSFTTKLPHYFCIFFGFTVM
IISSTETILD------------------AVFGTEQKHCEI--------
>ZYRO0F16720g
--MSGGRGYEPL--TGSDQLG-------------TRSDPEFELSHFTSQNNSSKKDSHNS
LEGEEEEPEDREGTNDTTNLEYGIDDNYDNDDEFVNDVIRENNKKSTMKWAFMNMANSI-
LGAGVIGQPIAIKNSGIVGAIIAYLVLFVLVDWTLRLIVINLTLAGKKTYQDTVAFAMGK
RGRIAVLTANGLFAFGGCIGFCIIIGDTLPHVFRAFIHQNS----VFLSRRLIITIVTIC
ISYPLALQRNIAALSKASFLALISMVIIVFTVIIRGPEIHAKRD---PLTWEDILVTPRI
FRGISVISFALVCHHNTSFIYFSIKNRSLRKFNRLTHISTSISVVFCMIMGFSGFAAFGQ
NTKGNVLNNFSADDKAVNIARLCFGFNMLTTFPLEIFVLRDVIASFIG------------
----------GHQPNGDP-------------------NVLSKSNHFIITTILVFGTMSIS
LLTCNLGAIFELIGATTASMMAYILPPWVNLLLTSDK----TFRQKLPHFACIAFGFSIM
LISSIQTILD------------------TMNGTDEKQCEL--------
>TDEL0C06210
--MPKNDGYSRL--EEQSE-R-------------IPLELEFELVDF--DAKPGASD----
-----ETEENDSNEAKASSSNSAI------DESMVINLLRDNDKKSTMRWAFMNMANSI-
LGAGVVGQPFAIRNCGIIGGILAYIILVLLVDWTLRLIVINLTLAGKKTYQDTVEFALGR
KGRILVLLSNGLFAFGGCIGFCIIIGDTIPHFLQSIFHSSN----FFFRRNVVITIVTLF
ISYPLSLQRNIAALSKASFLALISMVVIVFSVVVQGPRVDMSLKGD-KWSLTDIFISSAI
FRGISVISFALVCHHNTSFIFFSIKNRSLQKFARLTHISTFISMIFCMLMGYSGYSVFRD
KTKGNILNNFPQDDLVINIARLCFGFNMLTTFPLEIFVLRDVIAAFLY------------
----G----KKEEDETEA-------------------PPLSTRKLFIITTVCVVSTMSIS
LTTCNLGALFELIGATTASTMAYILPPYTNLVLSKEA-N--TFRQKVPHYLCIFFGFMVM
IVSSTQTIIE------------------VVKGSDQRHCEL--------
>AFR671W
-MSVPNIQYSRLDGDETGKEG-------------TSVQSPFHTVQLNREWGDPSSS----
---NGDRIELIDYPTKSSTLSSGFDLE---EDSVLGAIVQESKGKVQYVYGLHEHGEQVS
LELVWSGSRLRLKNCGLLGGLVLTMLLTVIVDWTIRLIIINLKLTGKTTYQDTVEFAMGR
PGKYAVLFANGMFAFGGCVGFCIIIGDSIPHVLRAFFPNYI----EYFNRNMIITIVTIF
VSYPLSLNRNISKLSKASMLALVSLLLIVVIIVVRGPTVGNDYRG--SFDLEELFVKPRL
FQGISVISFALVCLHNTSFIYFSLRKPSLRRFNSLTHISCTISMVVCLIAGYSGFLTFKS
KTKGNILNNFPSSDNYINFARFCFGFNMLTTFPLEIFVLRDVIRDLIS------------
----------TETPKGEP-------------------LRLSTKRHFIITTALVLSTMGIS
LTTCNLGALLELVGSTTASLSAYILPPMTNLILTGER-R--AAKEKLPHYACILFGFSIM
VISSTQAIIT------------------AIHSDKSSQCDA--------
>KLLA0C02277g
MQIAADKKYAKLALSDKQSKN-------------EPNPFELELTSF---------D----
-----DTAKTADSAVDQNIFNVNE------EDPLTDDIYLSNEAKSNRYMAFMNMANSI-
LGSGVIGQPFAMKNCGIIGGLFATILMSILVDWTIRLIVINLKLTGKSTYQASVETAMGQ
WGGLLILVSNGLFAFGGCVGFCIIIGDSIPHVLSAFFPSHT----DLFHRNVIITLVTLF
ISFPLSLNRDISKLSKTSMLALLGLIAIVIIIVVKAPLVSGEYKG--TFHLHQLFITPRI
FQGISVISFALVCHHNTSFIFFSLRNPSLKRFNQLTHVSLILSCIVCLTTAYSGFLNFKD
KTVGNILNNFPSDDNVINFARLLLGFNMLTTFPLEIFVLRDVIRDIIY------------
----------YNKDDPEP-------------------VKLTTKMHALITSGLVLIIMCIA
LSTSNLGALLEIIGATSASLMAYILPPLTNLVITGKK-K--SLKEKLPYCGCIVFGVILM
FVSTAQTILE------------------AFA-----------------
>Ecym_1084
MKGTSKQPYKKLDSSEPEPAACTSKSTRHSSPIPVSSDLQFELSTF--------------
--HDYELLPTTSGARNNKNVQNNVELNLQFEDPNVSQLTNPNRGKSNMYMAFMNMANSI-
LGAGVIGQPFAIKNCGLIGGVCLIVLLTIIVDWTIRLIVINLKLTGKTTYQDSVEFAMGT
KGKLLILFVNGLFAFGGCVGFCIIIGDSIPHVLKAFFPSHS----ELFRRNVVISVVTLF
ISYPLSLNRNISKLSKASMLALVSLLLIVALVIIRAPKVEDEYKG--QFTWEEAFITPRV
FQGISIISFALVCHHNTSFIFFSLKNPSLKRFGNLTHISCIISMLVCLIAGYVGFLTFKD
KTKGNILNNFPSNDNFINFARFCFGFNMLTTFPLEIFVLRDVVRDLLY------------
----------FQSADSES-------------------IILTTKEHFIVTSVLVFISMSIS
LTTCNLGALLELVGSTTASLTAYILPPATTLALTGKT-K--TLKERTPYYACIMFGFSIM
IVSSTQTILS------------------AIYGTEIKHCEA--------
>SAKL0C02574g
MPPSISQPYAPV------------------------ADLQFELSSFDQHMQPAHAS----
-----GSAADEDDETKFVDTGADV------EDPLVSGIVTENQTKSNIYMAFMNMANSI-
LGAGIIGQPFAINNCGLAGGVAAIVLLTLLVDWTIRLIVVNLKLTGKTTYQDSVEFAMGR
RGKLLILAANGLFAFGGCIGFCIIIGDTIPHVLRAFFPAHT----ALFHRNAIIFFVTLF
VSYPLSLNRDISKLSKASMLALASMLLIVVIVIVKGPMLDAAYKG--SLTASKLFITPRI
FQGISVISFALVCHHNTSFIYFSLKNPSLKRFNKLTHLSCLVSMVVCFVMGYSGFLVFKD
KTKGNILNNFPSDDNVINVARFCFGFNMLTTFPLEIFVLRDVVRDLAH------------
---------FHSGEATAP-------------------AELSTKKHVAVTSALVFLTMTVS
LTTCNLGALFELIGATTASMMAYILPPLTNLLLTGRA-K--TLRQKLPYYGCIVFGFAVM
VISSTQTILA------------------AINGGEQKHCET--------
>KLTH0F02332g
-MSKDPFNEPFIQGRGSHDQR-------------GPLGDNFELSSF--------------
---------DRSTEVRPERLSVDS------EDRFTSTFLHEQRSKSNILMAFMNMANSI-
LGAGIIGQPFAVKNCGLLGGVLAIVLLSLLVDWTIRLIVVNLRISGKTTYQDSVELAMGR
KGKLLILLSNGLFAFGGCIGFCIIIGDTIPHVLRAFFSGHD----NLFHRNIVIVVVTCL
ISFPLSLNRDISKLSKASMLALASMVVIVVIVVIKGPGTDSAYKG--SFNSSNLLITPRI
FQGLSVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFIAMIFCFLMGFTGFLVFKD
KTKGNILNNFPGNDNAVNVARFCFGFNMLTTFPLEIFVLRDVIKDLMF------------
---------FNSEPKSQP-------------------RVLSLKLHVIISTALVFGTMAIS
LTTCNLGALFELIGATTASLMAYILPPWVNLKLVGGN-L--KWRDRIPHYVCIGFGFAIM
LISSTQTIIS------------------YINGGDQKHCET--------
>Kwal_33.13386
-MSKEAANEASIQEETFSDRD-------------ELLGSSFQLSSF--------------
---------DRNSQRNSERLIDGS------EDESTTAFLRENRSKSNIFMAFMNMANSI-
LGAGVIGQPFAIKNCGLVGGIFAVILLSVLVDWTIRLIVVNMKITGKTTYQDSVEFAMGR
KGKLLILLSNGLFAFGGCVGFCIIIGDTIPHVLRAFFPGHE----NLFHRNIIIILVTCF
ISFPLSLNRNISKLSKASMLALVSMVFIVVIVLVKGPMIDDAYKG--SFNTTELFFTPRI
FQGISVISFALVCHHNTSFIYFSLKTPSLKRFDRLTHFSCFVAMIFCFLMGYTGFLVFKD
RTKGNILNNFPGSDNVVNVARFCFGFNMLTTFPLEIFVLRDVIRDFMF------------
---------FNSKDTNQS-------------------QELSLKLHVILTTILVMTTMLIS
LTTCNLGALFELTGATTASLMAYILPPSVNLLLIGKR-S--TVREKLPHYACIIFGFTIM
VVSSSQTIIA------------------YIRGGDQKHCEV--------