MUSCLE (3.8) multiple sequence alignment

Suva_5.2         MDPATANRALPEEFTEVVVPEILEKEV----GTTTAAGPALTTSSPAPSY-IELIDPGVR
Skud_5.24        MDPSTASRALPEEFTEDIVPEIPEKEA----GTTVDVNPTLTISSPAPSY-IELIDPGVH
Smik_5.22        MDPATANHALPEDFTEDVVPDILEKEV----GAIVDVNPTLTTSSPAPSY-IELIDPGVY
YEL065W          MDPGIANHTLPEEFEEVVVPEMLEKEV----GAKVDVKPTLTTSSPAPSY-IELIDPGVH
Kpol_358.4       -MTSSSDSKFDGKINETVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVN
NDAI0I02650      -------MSLESSHSNQGEEEIAQKET-------YSVHSTDISSGSE----ISIKDAGVQ
NCAS0D02350      ---MSSVSTTDQDIHNLSTQAHTQDDS----IKKETVSATINSVSSLSEE--SVKDAGVN
                             .  :        .:             .               *.** 

Suva_5.2         NIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIK
Skud_5.24        NIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIK
Smik_5.22        NIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIK
YEL065W          NIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIK
Kpol_358.4       NIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSTVNAIT
NDAI0I02650      NIEVYAEQYKKPYYRVLLFFSLFLVAYAYGLDGNIRYTYQAYATSSYSQHSLLSTVNCIK
NCAS0D02350      NIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIK
                 ***:*** *. *  *. ****:**:********.:***:** ******:********.*.

Suva_5.2         TVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTG
Skud_5.24        TVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTG
Smik_5.22        TVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTG
YEL065W          TVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTG
Kpol_358.4       TVIAAAGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTG
NDAI0I02650      TVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTG
NCAS0D02350      TVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTG
                 *****.*** :** ******:::: :.::** :**:*****..::**:.*.****:* **

Suva_5.2         VILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPL
Skud_5.24        IILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPL
Smik_5.22        IILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPL
YEL065W          IILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPL
Kpol_358.4       VILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPL
NDAI0I02650      AMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPL
NCAS0D02350      AMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPL
                  :* :*:** *********:* *:******:******:*:.*:.  ***********.**

Suva_5.2         ACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKS-FSIDIVFWKLDLIGLLLVTAF
Skud_5.24        ACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKS-FCIDIAFWKLDIIGMLLITAF
Smik_5.22        ACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKS-FCIDIAFWKLDIIGMLLITVF
YEL065W          ACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKS-FCIDIAFWKLDIIGMLLITVF
Kpol_358.4       SAIPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFA-YIVDVFLWKLDFIGLLLLCAT
NDAI0I02650      ACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCF
NCAS0D02350      ACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKE-YFIDVFFWRLDMIGLLLIVCF
                 :.***. *:****:**.*::**.*   .   ..  .   : :*: :*.**:**:**:   

Suva_5.2         FGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRG
Skud_5.24        FGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRG
Smik_5.22        FGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRG
YEL065W          FGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRG
Kpol_358.4       FGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRG
NDAI0I02650      FGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRG
NCAS0D02350      FGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRG
                 ***:*:*******::.:*.:*********** * **::::**:*:*. ***** *::***

Suva_5.2         VLFALFIAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGFILI
Skud_5.24        IFFALLIAFFINFNWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILI
Smik_5.22        IFFALLIAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILI
YEL065W          IFFALLIAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILI
Kpol_358.4       IFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVII
NDAI0I02650      VFSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSVLTGTGLGLVLI
NCAS0D02350      VYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLV
                 :  **.**  *** ************:*:*:**:*:*****:*******:.** **:.::

Suva_5.2         KVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQA
Skud_5.24        KVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQA
Smik_5.22        KVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQA
YEL065W          KVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQA
Kpol_358.4       KVRRTKPFIIFGVSCWFIAFGLLVHYRGSSSSHSGIVGSLCLLGFGAGFFTYTTQASIQA
NDAI0I02650      KVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQA
NCAS0D02350      KLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFTYTTQTSIQA
                 *:*******:**:. *:::****:.***.*.:*:**:******** ** ***.**:****

Suva_5.2         SAGTHARMAIVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRISDPTLAAEAYGSPF
Skud_5.24        SAKTHARMAIVTSLYLATYNIGSAFGSSVSGAVWTNILPREISKRISDPTLAAQAYGSPF
Smik_5.22        SAKTHARMAVVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRISDPTLAAQAYSAPF
YEL065W          SAKTHARMAVVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRISDPTLAAQAYGSPF
Kpol_358.4       SVKYHSKMAVITALYLAMYNIGSAVGAAVSGAIWTNVLPKQISKRIANETLAAEAYGSPF
NDAI0I02650      TTRSHQKLAVITALYLAAYNIGSGLGSAVSGAVWTNVLPDRISKAIANQTLAAEAYGSPF
NCAS0D02350      TTRSHAKMAVITALYLACYNIGSSFGAAVSGGVWTNVLPDRISRGISNQTLAAEAYGSPF
                 :.  * .:*::*:**** *****..*::***.:***:**  **. *:: ****:**.:**

Suva_5.2         TFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIALEGND
Skud_5.24        TFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIALEGSD
Smik_5.22        TFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIALEGND
YEL065W          TFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIALEGND
Kpol_358.4       TFILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELE
NDAI0I02650      TFIITNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELD
NCAS0D02350      TFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMS
                 *** * ** *.:* *:* :** .******:** ** .** .* :**:* * . :**.  .

Suva_5.2         HLESKNDNEIVE------------KEETSLRTRFLAQFT-SKEKKN----------
Skud_5.24        YLESKDAFEPKE------------KEETFLKSKFLSQFT-GKNKEN----------
Smik_5.22        HLKSKDSFETEE------------KQESFLKSMIFTRFTRSEDKRN----------
YEL065W          HLESKNTFEIEE------------KEESFLKNKFFTHFTSSKDRKD----------
Kpol_358.4       NTPNSDEQ---------------------------GSFADNDKNVN----------
NDAI0I02650      EKNVKEDDPVVDFLAKFIPSLRNKKNSGNIPNTTHNNNYNNNSDIELVNTKSTETV
NCAS0D02350      EKVVEDDDPIFAFLKKCIPF----YNKKNGETSTVTTSTDGNDVVEMV--------
                     .:                                  ...  :          

FASTA FORMAT for MUSCLE Version 3.6

>Suva_5.2
MDPATANRALPEEFTEVVVPEILEKEV----GTTTAAGPALTTSSPAPSY-IELIDPGVR
NIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIK
TVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTG
VILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPL
ACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKS-FSIDIVFWKLDLIGLLLVTAF
FGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRG
VLFALFIAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGFILI
KVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQA
SAGTHARMAIVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRISDPTLAAEAYGSPF
TFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIALEGND
HLESKNDNEIVE------------KEETSLRTRFLAQFT-SKEKKN----------
>Skud_5.24
MDPSTASRALPEEFTEDIVPEIPEKEA----GTTVDVNPTLTISSPAPSY-IELIDPGVH
NIEIYAEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIK
TVIAAVGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTG
IILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPL
ACIPLGLCMLHMRYLARKHAKDRLKPEFEALNKLKWKS-FCIDIAFWKLDIIGMLLITAF
FGCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRG
IFFALLIAFFINFNWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILI
KVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQA
SAKTHARMAIVTSLYLATYNIGSAFGSSVSGAVWTNILPREISKRISDPTLAAQAYGSPF
TFIITYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIALEGSD
YLESKDAFEPKE------------KEETFLKSKFLSQFT-GKNKEN----------
>Smik_5.22
MDPATANHALPEDFTEDVVPDILEKEV----GAIVDVNPTLTTSSPAPSY-IELIDPGVY
NIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIK
TVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTG
IILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPL
ACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKS-FCIDIAFWKLDIIGMLLITVF
FGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRG
IFFALLIAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILI
KVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQA
SAKTHARMAVVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRISDPTLAAQAYSAPF
TFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIALEGND
HLKSKDSFETEE------------KQESFLKSMIFTRFTRSEDKRN----------
>YEL065W
MDPGIANHTLPEEFEEVVVPEMLEKEV----GAKVDVKPTLTTSSPAPSY-IELIDPGVH
NIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIK
TVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTG
IILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPL
ACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKS-FCIDIAFWKLDIIGMLLITVF
FGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRG
IFFALLIAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILI
KVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQA
SAKTHARMAVVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRISDPTLAAQAYGSPF
TFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIALEGND
HLESKNTFEIEE------------KEESFLKNKFFTHFTSSKDRKD----------
>Kpol_358.4
-MTSSSDSKFDGKINETVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVN
NIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSTVNAIT
TVIAAAGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTG
VILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPL
SAIPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFA-YIVDVFLWKLDFIGLLLLCAT
FGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRG
IFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVII
KVRRTKPFIIFGVSCWFIAFGLLVHYRGSSSSHSGIVGSLCLLGFGAGFFTYTTQASIQA
SVKYHSKMAVITALYLAMYNIGSAVGAAVSGAIWTNVLPKQISKRIANETLAAEAYGSPF
TFILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELE
NTPNSDEQ---------------------------GSFADNDKNVN----------
>NDAI0I02650
-------MSLESSHSNQGEEEIAQKET-------YSVHSTDISSGSE----ISIKDAGVQ
NIEVYAEQYKKPYYRVLLFFSLFLVAYAYGLDGNIRYTYQAYATSSYSQHSLLSTVNCIK
TVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTG
AMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPL
ACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCF
FGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRG
VFSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSVLTGTGLGLVLI
KVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQA
TTRSHQKLAVITALYLAAYNIGSGLGSAVSGAVWTNVLPDRISKAIANQTLAAEAYGSPF
TFIITNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELD
EKNVKEDDPVVDFLAKFIPSLRNKKNSGNIPNTTHNNNYNNNSDIELVNTKSTETV
>NCAS0D02350
---MSSVSTTDQDIHNLSTQAHTQDDS----IKKETVSATINSVSSLSEE--SVKDAGVN
NIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIK
TVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTG
AMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPL
ACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKE-YFIDVFFWRLDMIGLLLIVCF
FGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRG
VYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLV
KLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFTYTTQTSIQA
TTRSHAKMAVITALYLACYNIGSSFGAAVSGGVWTNVLPDRISRGISNQTLAAEAYGSPF
TFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMS
EKVVEDDDPIFAFLKKCIPF----YNKKNGETSTVTTSTDGNDVVEMV--------