MUSCLE (3.8) multiple sequence alignment

Suva_5.1        ------------------MASTESEKITNDRIVVRAIEPRDEEDWNRLWVEYQGFQKIVM
Skud_5.22       ------------------MSEKESEKMANDRIVVRAIEAGDEEAWNKLWVQYQGFQKIVM
Smik_5.21       ------------------MSNKEFEKMTSDRIVVRAIEPKDEDAWHKLWKEYQGFQKTDM
YEL066W         MKKTPDPSPPFASTKNVGMSNEEPEKMVNDRIVVKAIEPKDEEAWNKLWKEYQGFQKTVM
                                  *:. * **:..*****.***. **: *:.** :******  *

Suva_5.1        PSEVARTTFARFLDPQVKLWGALAFDTVTGSAIGFVHYLSHITAWQVEEVVYMNDLYVTE
Skud_5.22       PPEVGKTSFARFLDPTVKLWGALAIDTETGDAIGLAHYLSHLTSWHVEEVLYLNDLYVTE
Smik_5.21       PLEVATTNFARFLDPTVKLWGALAFDTETGNAIGFAHYLSHLTSWHVEEVIYMNDLYVTE
YEL066W         PPEVATTTFARFIDPTVKLWGALAFDTETGDAIGFAHYLNHLTSWHVEEVVYMNDLYVTE
                * **. *.****:** ********:** **.***:.***.*:*:*:****:*:*******

Suva_5.1        TARIKGVGRKLIEFVYKHADELGTPSVYWVTDHFNHRAQLLYTKVAYKTEKVVYKRVGH
Skud_5.22       HARIKGVGRKLIEFVYKHADELGTPAVYWVTDHYNHRAQLLYTKVGYKTDKVVYKRTGY
Smik_5.21       HARIKGVGRKLIEFVYKRADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRTGY
YEL066W         RARVKGVGRKLIEFVYSRADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRNGY
                 **:************..*******:*******:***********.***:**:*** *:

FASTA FORMAT for MUSCLE Version 3.6

>Suva_5.1
------------------MASTESEKITNDRIVVRAIEPRDEEDWNRLWVEYQGFQKIVM
PSEVARTTFARFLDPQVKLWGALAFDTVTGSAIGFVHYLSHITAWQVEEVVYMNDLYVTE
TARIKGVGRKLIEFVYKHADELGTPSVYWVTDHFNHRAQLLYTKVAYKTEKVVYKRVGH
>Skud_5.22
------------------MSEKESEKMANDRIVVRAIEAGDEEAWNKLWVQYQGFQKIVM
PPEVGKTSFARFLDPTVKLWGALAIDTETGDAIGLAHYLSHLTSWHVEEVLYLNDLYVTE
HARIKGVGRKLIEFVYKHADELGTPAVYWVTDHYNHRAQLLYTKVGYKTDKVVYKRTGY
>Smik_5.21
------------------MSNKEFEKMTSDRIVVRAIEPKDEDAWHKLWKEYQGFQKTDM
PLEVATTNFARFLDPTVKLWGALAFDTETGNAIGFAHYLSHLTSWHVEEVIYMNDLYVTE
HARIKGVGRKLIEFVYKRADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRTGY
>YEL066W
MKKTPDPSPPFASTKNVGMSNEEPEKMVNDRIVVKAIEPKDEEAWNKLWKEYQGFQKTVM
PPEVATTTFARFIDPTVKLWGALAFDTETGDAIGFAHYLNHLTSWHVEEVVYMNDLYVTE
RARVKGVGRKLIEFVYSRADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRNGY