MUSCLE (3.8) multiple sequence alignment

KNAG0B03690        --MG--------------------------------------------------------
TPHA0K00530        --MINSSKGEN-------------------------------------------NWSSKK
Kpol_1023.98       --MGNNISVDA------------------------------------TNEFRYKGKNIQY
Kpol_1004.21       --MGNHLSIGA------------RHTNYISDGDNSNVLGSNSLNDDALFKQRQGSIRSEL
KNAG0C03230        --M---------------------------------------------------------
KAFR0E03300        --MSRNSSDFD---------------GYYD------------------------------
TBLA0D01650        --MGNNPSILD-------------SETNESTNRNINNNSNNNNNSSTLIIERNDSITSTL
CAGL0F03047g       --M---------------------------------------------------------
NDAI0H01600        --MGNNPSTTD---------SENTAADLQEKKAGFHNKHLTRIQKQESPKERKGSITSHL
NCAS0F01090        MDMGNNPSSSE--------HTQKDKEEEEEEEAIKDTIILHNKHLDHLQDERKGSISSNL
ZYRO0D12562g       --MGNTPSAHQ--------RVGRKGSENFQESNNSSNRYSQTKYLLEVDKGRQSSITSQL
Suva_2.599         --MGNSPSTQD------PSHSAKKDHSHHL-----------HE---AFNKDRQGSITSQL
YDR422C            --MGNSPSTQD------PSHSTKKEHGHHF-----------HD---AFNKDRQGSITSQL
Skud_4.696         --MGNSPSTQD------PSHSSKRNHGYHL-----------HE---AFNKDRQGSITSQL
Smik_4.697         --MGNSPSTQD------PSHSTKKEHGYHF-----------HE---TFNKDRQGSITSQL
Ecym_4065          --MGNTTSSTDWGYQKVGRYQQQQQQRRQQRQGVGGEAKGGSVQHGTKERVRQQSITSQL
TDEL0A03910        --MGNSPSVQE---------HQQQPHGVLDANHPFRRAQLGNE----MNSGRQQSITSQL
ADR194C            --MGNTVSSTE--------GSKRRGDGRAGTPAASGASQWETD---STDRGRQQSITSQL
SAKL0G04928g       --MGNTASTVN--------LQEKRHHSHL------------------LPRDRQHSITSQL
KLTH0G03762g       --MGNNPSTAN--------MQNKRVSQLAQ-----------------EPRGRQDSITSQL
Kwal_47.18642      ------------------------------------------------------------
                                                                               

KNAG0B03690        ------------------------------------------------------------
TPHA0K00530        YPN-------------------------------------------------DLRNTPPP
Kpol_1023.98       FNPYYNKDKKDISN----------------------------------------------
Kpol_1004.21       FTSRNNSNRNKIYS-----------ELAARNNLTTIN----------------SSNTNVK
KNAG0C03230        ------------------------------------------------------------
KAFR0E03300        ------------------------------------------------------------
TBLA0D01650        FPSRSSSSR--------------------QKYLTKNQ-----------------GENPNN
CAGL0F03047g       ------------------------------------------------------------
NDAI0H01600        FSSKGSSKRHALMPK----------PIEAQGNIKSHN-----------------------
NCAS0F01090        FTNKNSSKRHAT-------------SIMSQSKVTNDN-----------------IQNPPE
ZYRO0D12562g       FPSRKTRHA------------------PSGLGNLKRK---------------TQNVVPHP
Suva_2.599         FNNRKSIHKRHSSHANYDN-----AAIPPRMQLLASQPSTSSTSDCDDSTNNDVSAASEP
YDR422C            FNNRKSTHKRRASHTSEHN-----GAIPPRMQLLASH---DPSTDCDGRMSSDTTIDKGP
Skud_4.696         FNNKKSVHKRHTSHASSHK-----AAIPHRMQLLASH---DVASDCDSSVNNDTIIDKEP
Smik_4.697         FNNRKSIHKRHVSHTSGHN-----GTIPSRMQLLASH---DSVTDCDDSVNDDTTIDKEP
Ecym_4065          FPGRHQARS----------------KWKSQRNVAPGA----------------VSGVGGV
TDEL0A03910        FPSRNTRHVG-----------------PHSMNAKRNR-----------------HPHPQP
ADR194C            FSGRHHARS----------------KWKFQGAGDSAT-----------------GSSGGI
SAKL0G04928g       FPGRNTRNAQDDSPVSAAAAAAAPGKWKRRLSLNHAP-----------------AVVSTP
KLTH0G03762g       FPSRTSGRNPESKV-----------GWKSRVLHGNRP-------------SASPASTPPV
Kwal_47.18642      ------------------------------------------------------------
                                                                               

KNAG0B03690        ------------------------------------------------------------
TPHA0K00530        TKGSSMGYKKY-------------------------TGLPNLNER---------------
Kpol_1023.98       NLILENSVNL--------------------------ENFNNQNTMNL-------------
Kpol_1004.21       ESLFKKDYSMGRHP----------------------NTVNHVKNRVD-------------
KNAG0C03230        ------------------------------------------SSHSL-------------
KAFR0E03300        ------------------------------------------------------------
TBLA0D01650        VSLFKQNYSLTQNNETYEPILKPL------------SSPENDTNITY-------------
CAGL0F03047g       HSLFKEDYSV-----------------------------TKEASEPE-------------
NDAI0H01600        --VFKKDYSMDEPL----------------------TNKGGIKNNDF-------------
NCAS0F01090        TVFFKKGYSISRSMQDD-------------------SDIKTEGQATV-------------
ZYRO0D12562g       PSLFKKNYSLEEASAGAQGPNNNNNDNHNVTLMAADDDPRDFNDTKT-------------
Suva_2.599         SPLFKKDYSV--------------------------AKAADDNETTL-------------
YDR422C            SHLFKKDYSL--------------------------SSAADVNDTTL-------------
Skud_4.696         SPLFKKDYSL--------------------------ANAADENDTTL-------------
Smik_4.697         SLLFKKDYSL--------------------------NNTADGNDTTL-------------
Ecym_4065          DHLFKRDYSLSDDSSA--------------------VGMEGVQEEGG-------------
TDEL0A03910        PSLFKSDYSLR-------------------------STAEETPANTG-------------
ADR194C            ASMFKCDYTLN-------------------------ADARSISSEQG-------------
SAKL0G04928g       SPLFKPNYSMNESSNASIAGLGSNYTTSSQEDLNKLQAVDSSRKNTLSSIESNSASSKPA
KLTH0G03762g       QSPFRKNYTLEVTTESAPYNLKKSISGNPAPPM---CTTTHASADES-------------
Kwal_47.18642      ------------------------------------------------------------
                                                                               

KNAG0B03690        ---------------AGQSTLVALSADTV-------------------------------
TPHA0K00530        ------------ADDTMLSNLAHLTLTT--------------------------------
Kpol_1023.98       ------------SNNNLMECLAKLSIDHS--------NSNSNYSYSTK------------
Kpol_1004.21       ------------FTRNSSNEYSSSSLSSN-------------TDSAYT------------
KNAG0C03230        ------------DEGNIGKNLANLRLDAA----------------AVA------------
KAFR0E03300        ------------DDSIINQDMANLSLESS---------------NTDD------------
TBLA0D01650        ------------NNSTFNNSRASKNSDQD----IIRNDNDPINNQQQP------------
CAGL0F03047g       ------------ADESIDVNMAGLSLTSS-------------MGDGSA------------
NDAI0H01600        ------------NDENIHETMASLSLVTS-----------SDNERKKS------------
NCAS0F01090        ------------DSENIHEPMASLSLKTS----------MENDENRKS------------
ZYRO0D12562g       ------------STESVRENMAGLSIKSS---------------NETG------------
Suva_2.599         ------------ANLSLYDRHDASAPEEQ----------------VKS------------
YDR422C            ------------ANLTLSDDHDVGAPEEQ----------------VKS------------
Skud_4.696         ------------ANLSLNDDHDGSAPEEQ----------------VKS------------
Smik_4.697         ------------ANLSLIDDHDVGAPEEQ----------------VKS------------
Ecym_4065          ------------VDLIGMPNVAGLKLDSR------------------A------------
TDEL0A03910        ------------STENIRDNMAGLSLKSS-------------NENAQV------------
ADR194C            ------------ETCQGMPNLAGLVLDAC------------------T------------
SAKL0G04928g       PPLLNPTNVSADDSSQLRDHLAGLTIHSEGLSRNVSNAVSRSSYDSSATPNPATNYVSSP
KLTH0G03762g       ------------SSSSLRDHLAELSLQNSESQPNRKTSPGLGPAPAPA------------
Kwal_47.18642      ------------------------------------------------------------
                                                                               

KNAG0B03690        ----NKFKPS--------------------------------------------------
TPHA0K00530        ------FCPA-EAVNIMAFEEPL---------------------------------RNNY
Kpol_1023.98       ---TLFMNPG-HSSPVVCQTPRL-------------------------------TATGSF
Kpol_1004.21       ---PSFFSLG-PSTATVEQSTEK-----------------------VIRLDEQHHPHQNL
KNAG0C03230        ---DGVQTDGSDGTRSVRSDVHR-------------------------------------
KAFR0E03300        ---DGLLSSGLPSLTTTKH-----------------------------------------
TBLA0D01650        ---LLILSPG-PSHPTVEQSKQQANYNEDQEMFKNGITQTKNSSSYRNTSPNIPSNTNNI
CAGL0F03047g       ---LHISSPG-PSNATVQTIKRE-----------------------VTHGDESPQGDSDD
NDAI0H01600        ---MSFARPG-PSTPTVQPTKHD-----------------------ITSLEGSTDVNTGI
NCAS0F01090        ---FSFMSPG-PANPTVEQTKHD-------------------------------------
ZYRO0D12562g       ---PMFFSPG-PATPTVQPTKEE----------------------AIPPMDDNMI-----
Suva_2.599         ---PTFLSPG-PSMATVKQTKNYPD--------------------DLSTVNNTIVDETIG
YDR422C            ---PSFLSPG-PSMATVKRTKSDLD--------------------DLSTLNYTMVDETTE
Skud_4.696         ---PSFLSPG-PSMATVKQTKSDLD--------------------DLSTVNCTVVDETME
Smik_4.697         ---PSFLSPG-PSMATVKQTKSDLE--------------------NLSTSNYTTVDEATE
Ecym_4065          ---QAIMSPG-PSSATVEHSKLE-------------------------------------
TDEL0A03910        ---PSFLTPG-HSTPTVQPTRQA----------------------AVPAADLKNKLQNGL
ADR194C            ---QGIRSPG-PSTATVEHTNLE-------------------------------------
SAKL0G04928g       RVYPFPLSPG-PASPTVEPTRHE---------------------AELLPTRSEVDGEAEN
KLTH0G03762g       ---PVLRSPG-PSTPVVKYTKHD-------------------------------------
Kwal_47.18642      ------------------------------------------------------------
                                                                               

KNAG0B03690        ------------------------------------------------------------
TPHA0K00530        GDKENSIHQNYKIESTKLIEFPLMAAEIDDAL------------------------SWSE
Kpol_1023.98       ENRSIFLNNDDSEASSLIIPKTFDESYLMDQN---------------S------------
Kpol_1004.21       ASKKDIVINHEHRPSILALKQNLYESSSGVPL---------------YDSQPSSEVPSEL
KNAG0C03230        -------HRHHHK-----------------------------------------------
KAFR0E03300        ------------------------------------------------------------
TBLA0D01650        INMNSHNYASSHRPSVVALKKSLEETLDFTTN---------------DPRQIYSSRSSQS
CAGL0F03047g       INAQHSRAMSEHRPSIVALKMSLKEVAEAAAAKRKNLPFRTINNVMDSQRSSISSSRDEI
NDAI0H01600        DNMNVAGDLNSHRPSIVALKNTLAESSIHPPS---------------DLSKTVSTSSNCQ
NCAS0F01090        --VTNKENSFEHRPSIVTLKQTLSGTKVTNDN---------------NIDKLNKTISSSS
ZYRO0D12562g       ---------FHNRQSVVALKKNLEESEQPSSR---------------SGS-SANMETRTT
Suva_2.599         DERKDHPHHERHRSSIIALKKTLLENSATASP---------------SPT-------RSS
YDR422C            NERNDKPHHERHRSSIIALKKNLLESSATASP---------------SPT-------RSS
Skud_4.696         NERSGHPHHERHRSSIIALKKTLMENSATASP---------------SPT-------RSS
Smik_4.697         DGRTNHPRHERHRSSIIALKKTLLENSATASP---------------SPT-------RSS
Ecym_4065          ASISPELAAQVHRPSIVALKQNLIQGHMGHPL---------------HSPLRDDYDGDDD
TDEL0A03910        NQQKEISSHRFQRPSVVALKKTLLDDGELHST---------------SSRSTSGDVVSSA
ADR194C            ASMSPELASQTHRPSISALKQSLIQVQGQTNS-----------------------RHRAE
SAKL0G04928g       DRYRDQFPSYLHRPSIVALKRSLVEGRIGSKL---------------HVQTSNGDTTNAS
KLTH0G03762g       -------AISDQISSITSLKKMLVEGRVGDNI----------------------------
Kwal_47.18642      ------------------------------------------------------------
                                                                               

KNAG0B03690        ------------------------------------------------------------
TPHA0K00530        SNDTFQLQPE--------------------------KNDFTMEESSN----------KRN
Kpol_1023.98       ------------------------------------------------------------
Kpol_1004.21       HSPSTRSFERQ------------------KSV----SIDIPQDNSNKKDL-------RNP
KNAG0C03230        ------------------------------------------------------------
KAFR0E03300        ------------------------------------VLTPPDD-----------------
TBLA0D01650        SFSTMSNTRSA-------------------------SIDIPTRNSASRVGSQYFD--ADF
CAGL0F03047g       FVDASPSPVVT------------------RTA----SIDIPRSEDGRRS--------SNR
NDAI0H01600        SFSTESSSSAL------------------HKTE---SIDIPRRHSQGFNENYNETMLKHP
NCAS0F01090        NSQSVSTASSS------------------SIANRTGSIDIPKENRYNFKDAMDTIP-KQH
ZYRO0D12562g       PIDNRRLKPLP------------------RQ-----AVAAAITATAT----------TAP
Suva_2.599         SIHSTSLLPLS------------------KAG----SIDIPIKQTYS----------KKP
YDR422C            SVHSASLPALT------------------KTD----SIDIPVRQPYS----------KKP
Skud_4.696         SVHSASLPPLT------------------KTG----SIDIPVKQTYS----------KKP
Smik_4.697         SVHSASMPPLT------------------KMD----SIDTPLKPAYS----------KKP
Ecym_4065          DGDTAPSSSYV------------------PSA----TIDIPYSNPSTMN--------TLS
TDEL0A03910        SLDIYSAL----------------------------NLDSPTQSGSK-------------
ADR194C            DIDTAQYVPSA-------------------------TIDIPCSNPST----------NTA
SAKL0G04928g       SSTAGSLKNYILDDNNRILLPSQLIDDDRQDSGRTDSIDIPGRGHAA----------TAT
KLTH0G03762g       ------HPPPT-------------------------SIDIPRRPSAA-------------
Kwal_47.18642      ------------------------------------------------------------
                                                                               

KNAG0B03690        ------------------------------------------------------------
TPHA0K00530        NLSFAKLSKS--------------------------------------------------
Kpol_1023.98       ------------------------------------------------------------
Kpol_1004.21       ILINLEYNERNNK-----------------------------------------------
KNAG0C03230        ------------------------------------------------------------
KAFR0E03300        ------------------------------------------------------------
TBLA0D01650        NVPRFENDFLHPDEPALNQKLIQNMLTQERRKDQHNNQSFFTTDTTNGIPNGLTNSSKHF
CAGL0F03047g       LVNSKPYLY---------------------------------------------------
NDAI0H01600        TVHSYQYQYFNNENTNN-------------------------------------------
NCAS0F01090        SVHAYQHDYFTINDENARNG----------------------------------------
ZYRO0D12562g       ATPNGR------------------------------------------------------
Suva_2.599         SVHAYQYQYLDPDP----------------------------------------------
YDR422C            SIHAYQYQYLNNDE----------------------------------------------
Skud_4.696         SVHAYQYQYLSPDP----------------------------------------------
Smik_4.697         SIHAYQYQYLSPDP----------------------------------------------
Ecym_4065          IIAQHQEDYS--------------------------------------------------
TDEL0A03910        ---AKDTD----------------------------------------------------
ADR194C            SVTHRADDSS--------------------------------------------------
SAKL0G04928g       IGSNRDTTALSDDQDTS-------------------------------------------
KLTH0G03762g       ------------------------------------------------------------
Kwal_47.18642      ------------------------------------------------------------
                                                                               

KNAG0B03690        ------------------------------------------------------------
TPHA0K00530        ------------------------------------------------------------
Kpol_1023.98       ------------------------------------------------------------
Kpol_1004.21       ------------------------------------------------------------
KNAG0C03230        ------------------------------------------------------------
KAFR0E03300        ------------------------------------------------------------
TBLA0D01650        RDEPSASSNKIQNTKRNNSLNLSSQFDIDMNDNTRTNFIRAGADFKNSKDDANRTISKLL
CAGL0F03047g       ------------------------------------------------------------
NDAI0H01600        ------------------------------------------------------------
NCAS0F01090        ------------------------------------------------------------
ZYRO0D12562g       ------------------------------------------------------------
Suva_2.599         --------------------------------------------------------T--L
YDR422C            --------------------------------------------------------T--F
Skud_4.696         --------------------------------------------------------T--F
Smik_4.697         --------------------------------------------------------T--F
Ecym_4065          ------------------------------------------------------------
TDEL0A03910        ------------------------------------------------------------
ADR194C            ------------------------------------------------------------
SAKL0G04928g       ------------------------------------------------------------
KLTH0G03762g       ------------------------------------------------------------
Kwal_47.18642      ------------------------------------------------------------
                                                                               

KNAG0B03690        ------------AKRDKRDEHHDGAKYTRE-NYDNFYNYN--------------------
TPHA0K00530        ------------TNKRSKVTSSSVAGNVYH-TQRQTQN----------------------
Kpol_1023.98       ------------ALFTIEQSSNDDDRKYTT-KENKNKTSH--------------------
Kpol_1004.21       -NESNFQNEIQPNNLNVNYNNNGNSNNYSA-DEDMVWNQS--------------------
KNAG0C03230        ------------HKHVQGTEALDPDSGIVQ-NQDRVLNQA--------------------
KAFR0E03300        ------------SSNTESVMSSANLRSTLT-DDYDSINQS--------------------
TBLA0D01650        RDDTDV------TSSTLIQDDGDDDDILLS-RKSVAFDQETSGDQTLTFKPSTVSQTEMD
CAGL0F03047g       ------------NYEPSGVPVGDPDGGMLQ-GTDVVLNQE--------------------
NDAI0H01600        -DGGLHKHKENFNDMQLSTSNDDEESGVLQ-SADIVVNQS--------------------
NCAS0F01090        ------------SDGRLSTSGDNSEPGVLQ-NVDIVLNQS--------------------
ZYRO0D12562g       -PSID-------TDPESSDIDNISDDGYLH-SKDIVLNQS--------------------
Suva_2.599         SDDSQ-------LDKESKSDNIDAEAGVLQ-SEDMVLNQS--------------------
YDR422C            SENSQ-------MDKEGNSDSVDAEAGVLQ-SEDMVLNQS--------------------
Skud_4.696         SGNSH-------TGKEANGDNIDAEAGVLQ-SEDMVLNQS--------------------
Smik_4.697         SGNSQ-------AGKEKNSDNIDAEAGVLQ-SEDMVLNQS--------------------
Ecym_4065          ------------TRSSAVSISTQDLDGYIE-NSDVVLSEA--------------------
TDEL0A03910        ------------ADPDTSDFDDISDDGYLQ-SEDVVLNQS--------------------
ADR194C            ------------TRSSLLSLFTQDVEEYIE-ASEVVLNES--------------------
SAKL0G04928g       ------------LSPGSPVSQLDLSEGFLE-DNDVLLNNA--------------------
KLTH0G03762g       ------------LSDAYFSDDGDDEESLLQGTNDVVINNS--------------------
Kwal_47.18642      ------------------------------------------------------------
                                                                               

KNAG0B03690        -LLE--------------------------------------------------------
TPHA0K00530        -LYDHVSDSDFFSAKSKSDLIIPSN-----------------------KRSASESRNQIL
Kpol_1023.98       ----FSWKKEMKR----RISRISKDKHPKD------------------------IYYDGS
Kpol_1004.21       -LLN-------------GLITSNNDYIDNN---------------------------INN
KNAG0C03230        -ILQHAIKKDMKRKRNDSNASGTAAAVLHNHRQQ--------------QQQEENVEGPTL
KAFR0E03300        -TLQNVMKR---------------------------------------------------
TBLA0D01650        VLLDPIGISTRKSKRGNVKSNKKPKAFIRDGQKIYPGEDEDDEIVETITSNRRNNISSTI
CAGL0F03047g       -LLEQALKRDMKRKRADTMQSSTVELNKKV------------------DTNTSKNSNHTE
NDAI0H01600        -TLQNALKRDMKRKRTDTISTNKSGAPTSD-----------------------ALKAKDE
NCAS0F01090        -FLKDAMKRDMKRKRTDTGASTA-----------------------------------TP
ZYRO0D12562g       -LLHNVIKRDMKRKRDKETNDSNNNLVATKTLEQDGGTN---------NTSTNAFISKNS
Suva_2.599         -LLQNALKKDIQRLS--RVNSSNSTYTIDSATHNNNNNNNNNSNSNNSSNSENNIGYKEN
YDR422C            -LLQNALKKDMQRLS--RVNSSNSMYTAERISHANNN-----------GNIENNTRNKGN
Skud_4.696         -LLQNALKKDMQRLS--RANSSNSTYTMGRENRINN--------------SESNIDGKEN
Smik_4.697         -LLQNALKKDMQRLS--RANSSNSTCTIENSNNNNNY-----------SSSENNIRNKED
Ecym_4065          -LVDSVVKNDMRRKRQLQKQSAEASEAINE------------------------NKNEAN
TDEL0A03910        -LLQNVLRRDMKRKRPAKKSKVPNTSHVSNL-----------------KASSNSVSYESL
ADR194C            -LVDSVVRKDLRRKRQLQQQCGATRAAEQA--------------------------AETA
SAKL0G04928g       -VLESAIRKDMKRKRQEKKRPEDQEKSFSSSLESAE------------PSAISGVKKLKP
KLTH0G03762g       -VLENAMKRKRGTKKNKGVGASSESHE---------------------HISYPGLKKLKP
Kwal_47.18642      ------------------------------------------------------------
                                                                               

KNAG0B03690        --------------------------------------LVRGQRVPHFYRQPRR------
TPHA0K00530        HNETMPNSKLFHN----------------------YRFHYINQNNLNGRTHSKNSSNAI-
Kpol_1023.98       EEDESDDSNAIVH------------------RHTKDRKRLKSDITVDPSLSDKDSSEIK-
Kpol_1004.21       KNFNLNHHKYP---------------------------KFENSISPTFNDSNDGNVHYD-
KNAG0C03230        VGAQTGAASGEMS------------------ATAAIMLKLYGDKNQLAHEVHEAREVHE-
KAFR0E03300        -----KRSEQPMS------------------QTAKTMLKLYGNSAEREREQEAKNASLL-
TBLA0D01650        SKPLSRIDDGPNNNGFVTTTRSSSNSSQKNLANLSRLTSIYGNSEEFKPQSERKYKPLQT
CAGL0F03047g       IMKNPPETAEPTS------------------ATAAMMMRLYGDRTLLNQQITKQKED---
NDAI0H01600        PEAKTKTEKPAMS------------------ATAAMMLKLYGDTTLKEKETFKNNTISGT
NCAS0F01090        DIEKPTEKKKPIS------------------ATAAMMLKLYGDKNQMEKEEKKSSGSYSY
ZYRO0D12562g       TLEPLGNHGNP---------------------------KVHDVTINLESESPRGQSGLS-
Suva_2.599         SSDSNDDSGAPIS------------------ATAKMMMKLYGDKTLMERDLNKHQNKSL-
YDR422C            AGGSNDDFTAPIS------------------ATAKMMMKLYGDKTLMERDLNKHHNKT--
Skud_4.696         SIDPSDDSTVPIS------------------ATAKMMMKLYGDKTLMERDLNKHQNKT--
Smik_4.697         SGSFNDNSNVPIS------------------ATAKMMMKLYGDKTLMERDLNKHQTKT--
Ecym_4065          QQPDVKKAKVPMS-------------------------NLLKPSKQM-------------
TDEL0A03910        ENGNVPDAKKLKS-------------------------LSYDGSLPSFQPTAQNNDRLN-
ADR194C            KQPDAKKKKLPCS-----------------------------------------------
SAKL0G04928g       LTPNEQERQRQVG-------------------------EDYKNFLPSFQPIRTGATPKL-
KLTH0G03762g       LEHGGDKRDLP----------------------------HFRAMHPRPSEDNVGPDSAAI
Kwal_47.18642      ------------------------------------------------------------
                                                                               

KNAG0B03690        ------------------------------------------------------------
TPHA0K00530        ------QNDFNMSTELLRTPELETPDHIETIEVDSINGL--------------------S
Kpol_1023.98       ------KEEDNIGSIPIDFTPSNNNEINKKSN---------------------------F
Kpol_1004.21       ------GKQHCSGTEGYHFSDKKTSNIVNRTQFSS------------------------L
KNAG0C03230        ------VKSAASNVRLPEVKKIKKPLPEKE-----------------------------T
KAFR0E03300        -----------------------------------------------------------S
TBLA0D01650        VDNKPYKHLQRTDSNNHDTRSYKPLQRVTSNNSSSGKLNLKRLSSLEAPSKIYSS----R
CAGL0F03047g       ------ENKYSHTITNAAYKKLKPFSGVKRKILSNPNLNLQPLEPI-------------R
NDAI0H01600        IRYDDFYKRSESSVNLPENKKLKSFDNNTKNGNGYVSVSGNPNSGLSNTYNSNSNLSFSS
NCAS0F01090        ------ADQYEHSTSQINLREVKKIKHIENDFVEDNFGI--------------------S
ZYRO0D12562g       ------YDSLELG-HLQDVKKLKSIPHDMIMPHASAVGKIRPEVLQ-------------Q
Suva_2.599         ------KKVQNKKLRSASNSRRSSFASLHSLQPRKSVLTNSLNLQP-------------L
YDR422C            ------KKAQNKKIRSVSNSRRSSFASLHSLQSRKSILTNGLNLQP-------------L
Skud_4.696         ------KKAQNKKLRSASNSRRSSFASLHSLQSKKSILTNGLNLQP-------------L
Smik_4.697         ------KKVQNKKLKSVSNSRRSSFASLHSLQSKKSILTNSLNLQP-------------L
Ecym_4065          ------GTVTGTFLPQSELKDSGSFE---------------------------------Y
TDEL0A03910        ------GLAHDNGFNRIDSFEKGSVEHREVET---------------------------S
ADR194C            -----------------------------------------------------------A
SAKL0G04928g       ------FQVSGNG-GRIDSFELGTVEHFESIGDDHRTVSGGSNAPN-------------G
KLTH0G03762g       ------PRLITDSLNRIDSFEKGTVEHYEGANESG------------------------F
Kwal_47.18642      ------------------------------------------------------------
                                                                               

KNAG0B03690        ------------------------------------------RTKVKLRFRDSHT--IPF
TPHA0K00530        TDSLLSLAEESQGHAEESKSI----------------AHDVQKTRVTLRWIDSKF--KPN
Kpol_1023.98       SLHYNDYVNCISSNGTPSITLDTGSSISTAEYELTSLRRYHSRVNVVLRWRDSYI--QNE
Kpol_1004.21       ASKQISYRNSSAFSSTFSLDL------------------GSENVRVFLKWRDLID--DIE
KNAG0C03230        EKVRTQVAAADEQFSNFSDFE-------------------NENVRVILKWRDPQL--QPY
KAFR0E03300        LPNTKKFKNESAGTDSDVDDD-------------------NDDVEVILKWREPID-----
TBLA0D01650        ELLRQLSSRSSRIGSLKDQLDSPSDLSKVTSYFSTDTESAAELQNVIIKYRDPMEESEIP
CAGL0F03047g       PNEPPTSGQRTPNNSAHVHSE----------------SPSPDRTNVILKWRDSQNQSNNK
NDAI0H01600        SPRDIKIQHIDDVKTHLPSSFSSSTSSTSSSLGSSAGLI-NDNVHVVLKWRDQID--NPK
NCAS0F01090        SPKEIKIQHIDDVKNAPPSSL--SSSMSSSSFGPSSDEQTNDNVQVVLKWRDQID--NPK
ZYRO0D12562g       HGKFYSMDSFEKGSVEHREVEDRNRNSSLSSLSSSPVSGSSQDVHVAIKWRDHLP--VDG
Suva_2.599         HPLHPIINDNDSQYSVPQHREIPHHYNSMSSMSSISSTNSSESTLVILKWKNNSN--MPA
YDR422C            HPLHPIINDNESQYSAPQHREISHHSNSMSSMSSISSTNSTENTLVVLKWKDDGT--VAA
Skud_4.696         HPLHPIINDNESQYSAPQHREISHHSNSISSMSSISSTNSTENTLVVLKWKSDTN--MTA
Smik_4.697         HPLHPIINDNESQYSAPQHREMSHPSNSMSSMSSISSTNSAESTLVILKWKNYSN--MAV
Ecym_4065          GSVQHVEVAADDNYSDDC----------------------PERVQVIIKWRDTNV--DPR
TDEL0A03910        PTMRNSSSASPSSSSIISNTE-------------------PEKVHVILKWRDQIE--DPS
ADR194C            AALSATASGVVQSETEEQHSD-----------------AEAEFVEVIIKWRDCLL--DPQ
SAKL0G04928g       GGKTTSMRANKEAEEEEEEEA-----------AAGARYGEDDLVNVVLKWRDCIV--DPK
KLTH0G03762g       SSQNLTSSDMRDSDDADEDRG--------------------PGTHVILNWKDNIV--DPK
Kwal_47.18642      ------------------------------------------------------------
                                                                               

KNAG0B03690        RVHSVAIQGTDITSKLQRTG------------KMGGLQQIPLQFEGDSSEWVAPDLYLPP
TPHA0K00530        NYQSVSIISEDIIDVINFYR-----------SNNDKIKRLPLKYDSLTHEWKISDLFLPA
Kpol_1023.98       TCKSVSIISEDILTSVQAQN-----------SGVLLISNFSMTYDKNENNWVLPDLFLPP
Kpol_1004.21       NAN-ISIVSNEILSVICMND-----------LDSENSDSARMVYYPDTSEWVTKYLFLPP
KNAG0C03230        QGTGAAIKSHDIYSTLRAIK-----SELITPERENKEDLLYLDYDAKKKDWFVPDLYLPP
KAFR0E03300        HNSAVAIVSKDIVSTLLTIA--KTHKSSIITFIERKKFKINLLYDIVTNEWYLPNLFLPP
TBLA0D01650        ETK-IQLISKDINTTLHYDT----------TDLLTENNKMELVYNKDEKAWILPNLMLPP
CAGL0F03047g       ELK-VYLVSNEICASLKNDD-KLFAEGKLLATDNSQFNKIPLSYDSHNNEWYVPDLYLPQ
NDAI0H01600        KCK-IAIISDDIVNALESSS-----SKRKSNTNNNDNNTLPMVFNPMIKEWYMPNLTLPP
NCAS0F01090        HCK-ISIVSDDISSAIPAKA--------------TKAGKLPMLFNPMIKEWYVPNLLLPP
ZYRO0D12562g       TNR-MSMVSEDIASTLSFER-----------QKHGARNTFPMRYEEETKEWVVPDLVLPV
Suva_2.599         TTE-VSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAVHKEWFVPELFLPP
YDR422C            TTE-VFIVSTDIASALKEQRELTLDENASLDSEKQLNPRIRMVYDDVHKEWFVPDLFLPA
Skud_4.696         TTE-VSIVSNDIASALKEQREVNLDDDASLDSEKPLNSRIRMIYDSVHREWFVPDLFLPA
Smik_4.697         TTE-VSIVSNDIASALKEQREVDADESASLDSEKQLNPRIRMVYDNVHKEWFFPDLFLPP
Ecym_4065          TSK-ISIISSDIASVVQPTR---------------KRKKIPMVYLEQEQCWAAEDLKLPA
TDEL0A03910        KCK-ITIISTDIASALNFDP-----------SDKSFHGTFSMKYDEKENNFYVPNLSLPP
ADR194C            RTK-LSIVSPDIASVIHKNS----------------KRKVAMVFSKDEQFWVAPDLRLPP
SAKL0G04928g       TCK-ISVISSDISAVLALQS----------------SKKIPMEYETTEKSWFVPNLKLPP
KLTH0G03762g       TCK-MSIVSKDISSTLNPHK---------------KFSKIPMVFDMERNCWTAHDLYLPS
Kwal_47.18642      -----------------------------------------MVFDMESNCWIAPDLYLPA
                                                            : :      :    * ** 

KNAG0B03690        GEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVIENDEVVEP---------------
TPHA0K00530        GYYEFSFLINETDVHHSLHICTKMDRFGKRVNYFEVPKYVRTFEPLQL------------
Kpol_1023.98       GKYRLRFLIDHHDFRYSNYLPVTEDELGTIINEIEILPGYKSVEPFEH-----NNHIMIQ
Kpol_1004.21       GIYKLQFNVNG-SLRHSDYLPTATDNLGNIVNWFEVPRGYESIEPFRD------------
KNAG0C03230        GIYRLKFLING-MLLHSNFLPTATDAAGTIVNWFEVLPGYETIEPYRD------------
KAFR0E03300        GIYKLQFLING-NLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYRD------------
TBLA0D01650        GIYQVQFLVNS-DLKHSDFLPTATDDFGNIVNWFEVLSGYDFIEPFRD------------
CAGL0F03047g       GIYRLQFLVNG-NLVHSDFLPTATDDQGNIMNWFEVLRGYDRIEPYRDESEIQSDYTSSV
NDAI0H01600        GIYRLKFSINN-DITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPYRD------------
NCAS0F01090        GIYRLKFSING-DLTHSNFLPTATDSMGNIVNWFEVLPGYDTVEPYRD------------
ZYRO0D12562g       GVYRLQFLING-ELTHSNYLPTATDSVGNFVNWFEVIPGYEKVEPYRD----EVELDSGQ
Suva_2.599         GIYRLQFSING-ILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRD------------
YDR422C            GIYRLQFSING-ILTHSNFLPTATDSEGNFVNWFEVLPGYHTIEPFRN------------
Skud_4.696         GIYRLQFSING-LLTHSNFLPTATDSEGNFVNWFEVLPGYHTIEPFRD------------
Smik_4.697         GIYRLQFSING-LLTHSNYLPTATDSEGNFVNWFEVLPGYHTIEPFRN------------
Ecym_4065          GIYKLMFFING-QVRHSNYLPTATDSLSNIVNWFEVVPGYDQIEPYRD--------AAIE
TDEL0A03910        GIYKFQFVING-EIRHSNLLPSATDSVGNIVNWFEVIPGYESVEPFRNEIDYHENMGIDP
ADR194C            GIYKLQFLING-ALRHSNFLPTATDSHSNIVNWFEVVPWYDRAEPYRD------------
SAKL0G04928g       GVYKLQFLING-ELRHSNFLPTATDSFGNFVNWFEVLPGYYEIEPLRDVPVDSMNYGSDL
KLTH0G03762g       GVYKFQFLING-ELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRD------------
Kwal_47.18642      GVYKFQFLING-ELRHSEFLPTATDSFGNCVNWFEVVAGHKVIEPSRD------------
                   * * . * ::     :*  :       .   * : :       **               

KNAG0B03690        ---------------------AVAADAP--------------------------------
TPHA0K00530        --------SSA-------LYTVTQADDR---------------RHIECSKTSSEFL----
Kpol_1023.98       ENIINSELSLN-------NSRQLQSEPP---------------SYPELEENFSSPI----
Kpol_1004.21       NDYVKNEISGG-------ILQPIPNTLG---------------IPSVSSQLSSFSF----
KNAG0C03230        -----ESMIGQ-------DDESIDSQPY--------------------------------
KAFR0E03300        -------------------------------------------EERIIHREKSTAN----
TBLA0D01650        ENISSADNSDG-------T--LMQNIIP----------E----KLKTISMTKMAGN----
CAGL0F03047g       DTTLEGMENNGFQGSSDNSTTSMRNNNPVALNLQAPAP-----SKAQASRNSSYYS----
NDAI0H01600        EIIETTFHTAP-------SQGTLSVHDL---------------TMIRSRRSSSFVS----
NCAS0F01090        EIIETTFHTNG-------SQGTLRDNNP---------------TTIRSRRSSSFVS----
ZYRO0D12562g       PLNAGNNGIAG-------SVLSLENQGSEGTVLMEPVPGKVNVRPPLASMHHSSNR----
Suva_2.599         ----EADTESQ-------VGSTIDVEAP-----IRPEPK----RLSSSSRKSSYYS----
YDR422C            ----EADIDSQ-------VEPTLDEELP-----KRPELK----RFPSSSRKSSYYS----
Skud_4.696         ----EADMDFQ-------MRSTLDEEAP-----IRPEP-----KRLSSSRKSSYYS----
Smik_4.697         ----EADLGSQ-------VEPVLEEESP-----IRPELK----RFSSSSRKSSYYS----
Ecym_4065          RSPNELAAYNE-------TSLLLTNETP------SPANI----RPPLINRGTSSSS-R--
TDEL0A03910        PQSDSSTSTGK-------HHDESPGKVP----LVQPVPG----RPPLAARHTSSYS----
ADR194C            PAPEE---------------VAMPPESP---QLTAPAAG----RPPLLKRGTSSSS-R--
SAKL0G04928g       GVSMKESVNGG-------SDFTITAPIP---------------RPPLLSQATSSSYRS--
KLTH0G03762g       VISSEDVKLSK-------DQIAVEQPAP----------E----RPALGSDGSSSSNWKGS
Kwal_47.18642      -VISNDFTENQ-------V--AISANDP------SASP-----RPPILSGSSSFSNWKNS
                                                                               

KNAG0B03690        ----MGQDSPLG------------------------------------------------
TPHA0K00530        ---------NLLDNYDIRTRYNAN---------FYSHNESGTGN----------------
Kpol_1023.98       ESIISEDELDNDQYSKVYGKRNNS----------IGQS-KTSLS----------------
Kpol_1004.21       --HASRPTTPYSDFAGI-NRSSPL----PLREKSPDVK-STNFDLE--------------
KNAG0C03230        -----KSTTDVTDYAGI-SRSSSVVSKHSKSNLRLPNLHITSLNKESSASVNEANETNEG
KAFR0E03300        ---ESISSNSLTDYAGI-SRSSSI---VSNKSSLI----SSSLK----------------
TBLA0D01650        ---GSKGSTPRSNYTGV-SRSNSL----SASSSSSVWK-SVNVN----------------
CAGL0F03047g       AKSFEKSITQFSDYTGV-SRTNSM--VSAVSPINNANTRDNDLE----------------
NDAI0H01600        AKSDLSSFTPYSDYAGI-SRSSSSVGTATKKASLVSLRGTNKLD----------------
NCAS0F01090        ANGDLASMTPYSDYTGI-SRSNSA--LNSKRTSLVSLRGVGKLD----------------
ZYRO0D12562g       ---VIRSNTPYSDYTGI-SRSSSA-----LRKSPINCT-TSSLD----------------
Suva_2.599         AKGVERPSTPFSDYRGL-SRSNSA----NLRDSFVRLK-ASSLD----------------
YDR422C            AKGVERPSTPFSDYRGL-SRSSSI----NMRDSFVRLK-ASSLD----------------
Skud_4.696         AKDGERPGTPFSDYRGL-SRSNSV----FLRGSFVRLK-ASSLD----------------
Smik_4.697         AKGVERPSTPFSDYRGL-SRSSSV----NMRDSFVRLK-ASSLD----------------
Ecym_4065          ARVIERTNTPISDYTGVLARNSCS------NPAIYRHK-SNNST----------------
TDEL0A03910        -NKQERSGTPYSDYTGV-SRCNSA----VRKSPLIHQT-LSSID----------------
ADR194C            ARVVERSNTPISDYTGI-SRSGSA------RPLLAHHK-SANSI----------------
SAKL0G04928g       SKYIERSTTPYSDYTGILSRSNSA------RPLLNQKK-SSSYD----------------
KLTH0G03762g       SRHVERSGTPFSDYTGLCSRSELT------KPELRHNN-TSSYD----------------
Kwal_47.18642      AKHIERSGTPYSDYTGLCSRTDLA------KPELRHKN-TSSYD----------------
                                                                               

KNAG0B03690        ---------ARVEYTNEILPLFE----GYCDSQQIDHTAQYKP-----------------
TPHA0K00530        -NF------NNNKYTNQIPELFKFSEKNIRELSTETEITFLEP----PS-----------
Kpol_1023.98       -IKPCI---SEVTYTNEIPQLFKITDNNCIVNENYERYGFVEP----PS-----------
Kpol_1004.21       -FSTAVPE-PKYDYTTEIPEIYKAVDLDLTTAKATETTTDDEDITKPPLYLG--------
KNAG0C03230        NDIQLLPE-PKYEYSTEIPELFQFDDVNTRKTNDIKEVRKESKLETLYP-----------
KAFR0E03300        -LTNLNLNDDEIKYTNEIPEIFK---FDSTANSNVNNQAFDMS-----------------
TBLA0D01650        -LFTPLEP-NKVEYSTEIPEIFK---------NTTENNTSNAPMQYHPE-----------
CAGL0F03047g       -FFPPIKP-KVYEYSNNIPALFR---ISCDMEDVDDDNGTENN----PRAF---------
NDAI0H01600        -LFTPIEP-KKIAYSKEIPELFK---IANSEDTNKMEIDDDGS----SP-----------
NCAS0F01090        -LFTPMEP-KKIEYSNEIPELFK---ISNSIEDEDDDEGDYGHNETLSP-----------
ZYRO0D12562g       -LHTALQP-KKYKYSNEIPELFKTAPITKANDENEDFTFGHME----PPTYD--WARGHP
Suva_2.599         -LMAQIKP-EILEYSNEIPSLFT---IGNGSATPIQEDLPS-------------------
YDR422C            -LMAEVKP-ERLVYSNEIPNLFN---IGDGSTISVKGDSDDVH----P------------
Skud_4.696         -LMAEIKP-EKLEYSNEIPNLFN---IGEASTTTSKDHFERLS----P------------
Smik_4.697         -LMAEIKP-EKLEYSNEIPNLFN---IADGGTTSVIRESRDSS----P------------
Ecym_4065          -DVDILPKQPTLIYSSDVPELFK---VGNASTGGSQQGSDKNKLQNPSKYL---------
TDEL0A03910        -LVTALQP-KKYEYSNEIPELFK---AGNVLGQSDENQFPTPP----PP-----PMNPPS
ADR194C            -ELSPIPR-CVLQYSTEIPELFK----------------PEGC----PP--------DPN
SAKL0G04928g       -VFAPLPP-KKYEYSTDIPELFK-----VNDEEDHDHDIPEDP----PSYSS--LLKGSE
KLTH0G03762g       -LLAPVPR-PKYEYTDEIPELFK-----------ANFDGSLVP----PPYEERELTKDGS
Kwal_47.18642      -LLAPVPR-PVYEYSNEIPELFK-----------ANFEGSSTP----PPYQESVPSQNPV
                                *: ::  ::                                      

KNAG0B03690        ----------KTHMNQKTFFYYAFQ--EQDAASGDYDAQFCERYTVPIIPPYFYSIDIT-
TPHA0K00530        YGEPSF-YNNIVDCSQEKLFLSLQQ--NGAVDSYVAEQVILQRYPVSELPIFFENISMEK
Kpol_1023.98       YGEPGL-ENRVIDCNQDILFATFQQ--NGAVDVELAEQLFLEKYPVPDLPVFLDSHFSEK
Kpol_1004.21       TGGNSI-FNDVIGCSQRDLFEKLSKNTGKGLNTDELEKIFLAKYPITDLPIYLNTDYMNK
KNAG0C03230        NGKFDFTLARVVNSNQDALFASIQK--IGKMTTEEAEEYFLTKFKVSDLPIYLNSTYLNK
KAFR0E03300        -------LSKVIDLNQDHVFASLQK--IARMNTDEAENYFLNRFKIHDLPIYLNSNFLNK
TBLA0D01650        RKRPGL-LHNVVDCSQEELFGDLLA--DGLMDTETAEQMFLDKYPVPELPIYLNSKYMTQ
CAGL0F03047g       YDRPSF-TNRVVDCNQDALFGDLQK--GGKMDAEEAENLFLKKYQVPDLPVYLNSTYLNK
NDAI0H01600        FERPSF-THKVIDCNQDKLFADLQR--DGNIDAETAEALFLNRYPIPDLPIYLNSTYLNK
NCAS0F01090        FEEPSF-TNRVVDCNQDKLFSDLQK--NGNIDAETAEMLFLNKYQVPDLPIYLNSSYLNK
ZYRO0D12562g       SSNAGF-GNQVVDCNQDELFTELQQ--GGLLDAETAEQLFLEKYPVPDLPIYLNSYYLNR
Suva_2.599         QDLPSF-THKVVDCNQDDLFATLQQ--GGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNK
YDR422C            QEPPSF-THRVVDCNQDDLFATLQQ--GGNIDAETAEAVFLSRYPVPDLPIYLNSSYLNR
Skud_4.696         QDRPSF-THKVVDCNQDDLFATLQQ--GGNIDAETAEAVFLSRYPIPDLPIYLNSSYLNR
Smik_4.697         QEQPSF-TYKVVDCNQDDLFATLQQ--GGNIDAETAETVFLSRYPIPDLPIYLNSSYLNK
Ecym_4065          QDSPNF-MKNVQDCNQDELFHYLQE--KWNMNAQEAEEVFLEKYSVPDLPIYLNSTSLNE
TDEL0A03910        YDQPSF-LENVVDCNQDNLFVSLQQ--GGLLDAETAEQLFLEKYTVPDLPVYLNSTYLNK
ADR194C            TAPGSF-NENIQDCNQDELFRFLQE--DWKMSAQEAEEVLVEKYPVPDLPVYLNSSYLNE
SAKL0G04928g       AEQPSF-HCRVQDCNQDRLFSDLQQ--HDRIDAQAAEEFFLQKYPVPDLPIYLNSSYLNK
KLTH0G03762g       QKPPSF-LHRVQDCNQDVLFADLQQ--NGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNA
Kwal_47.18642      KNQPSF-LHRVQDCNQDVLFADLQK--NGEIDSQAAEEAFLQQYPTPDLPVYLDSSFLNA
                                 .*  .*                :  :  .:    :* :: .     

KNAG0B03690        --------------PQ--D--NTLKVPLPI----QLANLNRTIFPSPEDICNDYLCIGCV
TPHA0K00530        LASHNNNLNKSHTNKHWLEGLTPNESDNITPKEPPHVILNHLVTQK---ISRNVVSVAVT
Kpol_1023.98       LFDNNDSSKNLNDMNG--EDIQIKNNGQDI----PHVNLNHVLTNK---ISNGMISVACT
Kpol_1004.21       ALEQHRNIVGVDDVMQ--E--EINVVNHIV----PHVNIKHLLTHN---IQDSVIAVACT
KNAG0C03230        NFS--------------------GEVNHII----PHVNLRHLLTTS---IKEDIICVGCT
KAFR0E03300        IFIRDNNNET---------------TNNTV----PHVNLNHLLTTS---IKDDTLCVACT
TBLA0D01650        IVGEINQPSG----SGPPSSLNNNDLNHII----PHVNLQHLLTSS---IREEMISVACT
CAGL0F03047g       IFHEFHQVAG----PS--T--QDSSINHII----PHVNLKHLLTSS---IRDGIVSVACT
NDAI0H01600        IFTQFQKQHNDPTLPA--S--SSIGLTHII----PHVNLNHLLTSS---IRDEIISVACT
NCAS0F01090        IFLQFQKQHNDPTPSA--NTASTIGITHII----PHVNLNHLLTSS---IRDEIISVACT
ZYRO0D12562g       IISEFQKNNY----PG--G--GSGGINHII----PHVNLNHLLTSS---IRDEMISVGCT
Suva_2.599         ILNQGNPNSE----SG--DK-DEGAINHII----PHVNLNHLLTSS---IRDEIISVACT
YDR422C            ILNQSNQNSE----SH--ER-DEGAINHII----PHVNLNHLLTSS---IRDEIISVACT
Skud_4.696         ILNQSNPNSE----FH--DG-DEGGINHII----PHVNLNHLLTSS---IRDEIISVACT
Smik_4.697         ILNQSNPNSE----PH--DR-DEGAINHII----PHVNLNHLLTSS---IRDEIISVACT
Ecym_4065          IFNKLQQNSA----MG--DLPKRKSLTHII----PHVNLNHLLTSN---IRDEIISVGCT
TDEL0A03910        IFNEFQKHNS----LG--S--NSSGLNHII----PHVNLNHLLTSS---IRDEMISVGCT
ADR194C            IFTKLQRSSV----TG--DV-KRSSFTHII----PHVNLNHLLTSS---IRDEIISVGCT
SAKL0G04928g       VFNQLQKDNN----AG--E--TKAVVNPVI----PHVNLNHLLTSS---IREEIISVGCT
KLTH0G03762g       VFSGFQDKTD-----------SKTRVNHIV----PHVNLNHLLTSS---IRDEIISVGCT
Kwal_47.18642      VFRGFQEKND-----------TKSKLNHIV----PHVNLNHLLTSS---IRDEIISVGCT
                                                       . :.. :  .   *    :.:. .

KNAG0B03690        ISYRGKYMAHLFYRPSPWE-----------
TPHA0K00530        TRYKQKYITQILYSPIKPD-----------
Kpol_1023.98       TRYKRKFVTHILYSPSTHSEVGF-------
Kpol_1004.21       VRYGGKFITQVVYSPCSVENDD--------
KNAG0C03230        TRYAGKFITQVIYAPCSYDKQ---------
KAFR0E03300        TRYVGKFITQIMYAPSSPTQSD--------
TBLA0D01650        TRYEGKFLTQILYTPCFYENLKSGENNELK
CAGL0F03047g       TRYAGKFITQVIYAPCGNDQLESKE-----
NDAI0H01600        TRYQGKFITQVMYAPCNYSSQENKAIS---
NCAS0F01090        TRYQGKFITQVMYAPCNYGNPEIKSS----
ZYRO0D12562g       TRYEGKFITQVIYAPCYYENGRTLH-----
Suva_2.599         TRYEGKFITQVIYAPCYYKTQKAHGNK---
YDR422C            TRYEGKFITQVVYAPCYYKTQKSQISN---
Skud_4.696         TRYEGKFITQVIYAPCYYKTQKAGGNN---
Smik_4.697         TRYEGKFITQVIYAPCYYKTQKARGNNEN-
Ecym_4065          TRYEGKFITQIMYAPCYYENYE--------
TDEL0A03910        TRYEGKFITQVVYAPCYYASGPKAEGKK--
ADR194C            TRYEGKFITQIMYAPCYYESSRK-------
SAKL0G04928g       TRYEGKFITHVVYAPCYYENTNRKEELV--
KLTH0G03762g       TRYEGKFITQIIYTPCYYSNKDGAH-----
Kwal_47.18642      TRYEGKFITQIIYTPCYYGNKEKSG-----
                     *  *:::::.* *               

FASTA FORMAT for MUSCLE Version 3.6

>KNAG0B03690
--MG--------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---------------AGQSTLVALSADTV-------------------------------
----NKFKPS--------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------AKRDKRDEHHDGAKYTRE-NYDNFYNYN--------------------
-LLE--------------------------------------------------------
--------------------------------------LVRGQRVPHFYRQPRR------
------------------------------------------------------------
------------------------------------------RTKVKLRFRDSHT--IPF
RVHSVAIQGTDITSKLQRTG------------KMGGLQQIPLQFEGDSSEWVAPDLYLPP
GEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVIENDEVVEP---------------
---------------------AVAADAP--------------------------------
----MGQDSPLG------------------------------------------------
---------ARVEYTNEILPLFE----GYCDSQQIDHTAQYKP-----------------
----------KTHMNQKTFFYYAFQ--EQDAASGDYDAQFCERYTVPIIPPYFYSIDIT-
--------------PQ--D--NTLKVPLPI----QLANLNRTIFPSPEDICNDYLCIGCV
ISYRGKYMAHLFYRPSPWE-----------
>TPHA0K00530
--MINSSKGEN-------------------------------------------NWSSKK
YPN-------------------------------------------------DLRNTPPP
TKGSSMGYKKY-------------------------TGLPNLNER---------------
------------ADDTMLSNLAHLTLTT--------------------------------
------FCPA-EAVNIMAFEEPL---------------------------------RNNY
GDKENSIHQNYKIESTKLIEFPLMAAEIDDAL------------------------SWSE
SNDTFQLQPE--------------------------KNDFTMEESSN----------KRN
NLSFAKLSKS--------------------------------------------------
------------------------------------------------------------
------------TNKRSKVTSSSVAGNVYH-TQRQTQN----------------------
-LYDHVSDSDFFSAKSKSDLIIPSN-----------------------KRSASESRNQIL
HNETMPNSKLFHN----------------------YRFHYINQNNLNGRTHSKNSSNAI-
------QNDFNMSTELLRTPELETPDHIETIEVDSINGL--------------------S
TDSLLSLAEESQGHAEESKSI----------------AHDVQKTRVTLRWIDSKF--KPN
NYQSVSIISEDIIDVINFYR-----------SNNDKIKRLPLKYDSLTHEWKISDLFLPA
GYYEFSFLINETDVHHSLHICTKMDRFGKRVNYFEVPKYVRTFEPLQL------------
--------SSA-------LYTVTQADDR---------------RHIECSKTSSEFL----
---------NLLDNYDIRTRYNAN---------FYSHNESGTGN----------------
-NF------NNNKYTNQIPELFKFSEKNIRELSTETEITFLEP----PS-----------
YGEPSF-YNNIVDCSQEKLFLSLQQ--NGAVDSYVAEQVILQRYPVSELPIFFENISMEK
LASHNNNLNKSHTNKHWLEGLTPNESDNITPKEPPHVILNHLVTQK---ISRNVVSVAVT
TRYKQKYITQILYSPIKPD-----------
>Kpol_1023.98
--MGNNISVDA------------------------------------TNEFRYKGKNIQY
FNPYYNKDKKDISN----------------------------------------------
NLILENSVNL--------------------------ENFNNQNTMNL-------------
------------SNNNLMECLAKLSIDHS--------NSNSNYSYSTK------------
---TLFMNPG-HSSPVVCQTPRL-------------------------------TATGSF
ENRSIFLNNDDSEASSLIIPKTFDESYLMDQN---------------S------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------ALFTIEQSSNDDDRKYTT-KENKNKTSH--------------------
----FSWKKEMKR----RISRISKDKHPKD------------------------IYYDGS
EEDESDDSNAIVH------------------RHTKDRKRLKSDITVDPSLSDKDSSEIK-
------KEEDNIGSIPIDFTPSNNNEINKKSN---------------------------F
SLHYNDYVNCISSNGTPSITLDTGSSISTAEYELTSLRRYHSRVNVVLRWRDSYI--QNE
TCKSVSIISEDILTSVQAQN-----------SGVLLISNFSMTYDKNENNWVLPDLFLPP
GKYRLRFLIDHHDFRYSNYLPVTEDELGTIINEIEILPGYKSVEPFEH-----NNHIMIQ
ENIINSELSLN-------NSRQLQSEPP---------------SYPELEENFSSPI----
ESIISEDELDNDQYSKVYGKRNNS----------IGQS-KTSLS----------------
-IKPCI---SEVTYTNEIPQLFKITDNNCIVNENYERYGFVEP----PS-----------
YGEPGL-ENRVIDCNQDILFATFQQ--NGAVDVELAEQLFLEKYPVPDLPVFLDSHFSEK
LFDNNDSSKNLNDMNG--EDIQIKNNGQDI----PHVNLNHVLTNK---ISNGMISVACT
TRYKRKFVTHILYSPSTHSEVGF-------
>Kpol_1004.21
--MGNHLSIGA------------RHTNYISDGDNSNVLGSNSLNDDALFKQRQGSIRSEL
FTSRNNSNRNKIYS-----------ELAARNNLTTIN----------------SSNTNVK
ESLFKKDYSMGRHP----------------------NTVNHVKNRVD-------------
------------FTRNSSNEYSSSSLSSN-------------TDSAYT------------
---PSFFSLG-PSTATVEQSTEK-----------------------VIRLDEQHHPHQNL
ASKKDIVINHEHRPSILALKQNLYESSSGVPL---------------YDSQPSSEVPSEL
HSPSTRSFERQ------------------KSV----SIDIPQDNSNKKDL-------RNP
ILINLEYNERNNK-----------------------------------------------
------------------------------------------------------------
-NESNFQNEIQPNNLNVNYNNNGNSNNYSA-DEDMVWNQS--------------------
-LLN-------------GLITSNNDYIDNN---------------------------INN
KNFNLNHHKYP---------------------------KFENSISPTFNDSNDGNVHYD-
------GKQHCSGTEGYHFSDKKTSNIVNRTQFSS------------------------L
ASKQISYRNSSAFSSTFSLDL------------------GSENVRVFLKWRDLID--DIE
NAN-ISIVSNEILSVICMND-----------LDSENSDSARMVYYPDTSEWVTKYLFLPP
GIYKLQFNVNG-SLRHSDYLPTATDNLGNIVNWFEVPRGYESIEPFRD------------
NDYVKNEISGG-------ILQPIPNTLG---------------IPSVSSQLSSFSF----
--HASRPTTPYSDFAGI-NRSSPL----PLREKSPDVK-STNFDLE--------------
-FSTAVPE-PKYDYTTEIPEIYKAVDLDLTTAKATETTTDDEDITKPPLYLG--------
TGGNSI-FNDVIGCSQRDLFEKLSKNTGKGLNTDELEKIFLAKYPITDLPIYLNTDYMNK
ALEQHRNIVGVDDVMQ--E--EINVVNHIV----PHVNIKHLLTHN---IQDSVIAVACT
VRYGGKFITQVVYSPCSVENDD--------
>KNAG0C03230
--M---------------------------------------------------------
------------------------------------------------------------
------------------------------------------SSHSL-------------
------------DEGNIGKNLANLRLDAA----------------AVA------------
---DGVQTDGSDGTRSVRSDVHR-------------------------------------
-------HRHHHK-----------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------HKHVQGTEALDPDSGIVQ-NQDRVLNQA--------------------
-ILQHAIKKDMKRKRNDSNASGTAAAVLHNHRQQ--------------QQQEENVEGPTL
VGAQTGAASGEMS------------------ATAAIMLKLYGDKNQLAHEVHEAREVHE-
------VKSAASNVRLPEVKKIKKPLPEKE-----------------------------T
EKVRTQVAAADEQFSNFSDFE-------------------NENVRVILKWRDPQL--QPY
QGTGAAIKSHDIYSTLRAIK-----SELITPERENKEDLLYLDYDAKKKDWFVPDLYLPP
GIYRLKFLING-MLLHSNFLPTATDAAGTIVNWFEVLPGYETIEPYRD------------
-----ESMIGQ-------DDESIDSQPY--------------------------------
-----KSTTDVTDYAGI-SRSSSVVSKHSKSNLRLPNLHITSLNKESSASVNEANETNEG
NDIQLLPE-PKYEYSTEIPELFQFDDVNTRKTNDIKEVRKESKLETLYP-----------
NGKFDFTLARVVNSNQDALFASIQK--IGKMTTEEAEEYFLTKFKVSDLPIYLNSTYLNK
NFS--------------------GEVNHII----PHVNLRHLLTTS---IKEDIICVGCT
TRYAGKFITQVIYAPCSYDKQ---------
>KAFR0E03300
--MSRNSSDFD---------------GYYD------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------DDSIINQDMANLSLESS---------------NTDD------------
---DGLLSSGLPSLTTTKH-----------------------------------------
------------------------------------------------------------
------------------------------------VLTPPDD-----------------
------------------------------------------------------------
------------------------------------------------------------
------------SSNTESVMSSANLRSTLT-DDYDSINQS--------------------
-TLQNVMKR---------------------------------------------------
-----KRSEQPMS------------------QTAKTMLKLYGNSAEREREQEAKNASLL-
-----------------------------------------------------------S
LPNTKKFKNESAGTDSDVDDD-------------------NDDVEVILKWREPID-----
HNSAVAIVSKDIVSTLLTIA--KTHKSSIITFIERKKFKINLLYDIVTNEWYLPNLFLPP
GIYKLQFLING-NLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYRD------------
-------------------------------------------EERIIHREKSTAN----
---ESISSNSLTDYAGI-SRSSSI---VSNKSSLI----SSSLK----------------
-LTNLNLNDDEIKYTNEIPEIFK---FDSTANSNVNNQAFDMS-----------------
-------LSKVIDLNQDHVFASLQK--IARMNTDEAENYFLNRFKIHDLPIYLNSNFLNK
IFIRDNNNET---------------TNNTV----PHVNLNHLLTTS---IKDDTLCVACT
TRYVGKFITQIMYAPSSPTQSD--------
>TBLA0D01650
--MGNNPSILD-------------SETNESTNRNINNNSNNNNNSSTLIIERNDSITSTL
FPSRSSSSR--------------------QKYLTKNQ-----------------GENPNN
VSLFKQNYSLTQNNETYEPILKPL------------SSPENDTNITY-------------
------------NNSTFNNSRASKNSDQD----IIRNDNDPINNQQQP------------
---LLILSPG-PSHPTVEQSKQQANYNEDQEMFKNGITQTKNSSSYRNTSPNIPSNTNNI
INMNSHNYASSHRPSVVALKKSLEETLDFTTN---------------DPRQIYSSRSSQS
SFSTMSNTRSA-------------------------SIDIPTRNSASRVGSQYFD--ADF
NVPRFENDFLHPDEPALNQKLIQNMLTQERRKDQHNNQSFFTTDTTNGIPNGLTNSSKHF
RDEPSASSNKIQNTKRNNSLNLSSQFDIDMNDNTRTNFIRAGADFKNSKDDANRTISKLL
RDDTDV------TSSTLIQDDGDDDDILLS-RKSVAFDQETSGDQTLTFKPSTVSQTEMD
VLLDPIGISTRKSKRGNVKSNKKPKAFIRDGQKIYPGEDEDDEIVETITSNRRNNISSTI
SKPLSRIDDGPNNNGFVTTTRSSSNSSQKNLANLSRLTSIYGNSEEFKPQSERKYKPLQT
VDNKPYKHLQRTDSNNHDTRSYKPLQRVTSNNSSSGKLNLKRLSSLEAPSKIYSS----R
ELLRQLSSRSSRIGSLKDQLDSPSDLSKVTSYFSTDTESAAELQNVIIKYRDPMEESEIP
ETK-IQLISKDINTTLHYDT----------TDLLTENNKMELVYNKDEKAWILPNLMLPP
GIYQVQFLVNS-DLKHSDFLPTATDDFGNIVNWFEVLSGYDFIEPFRD------------
ENISSADNSDG-------T--LMQNIIP----------E----KLKTISMTKMAGN----
---GSKGSTPRSNYTGV-SRSNSL----SASSSSSVWK-SVNVN----------------
-LFTPLEP-NKVEYSTEIPEIFK---------NTTENNTSNAPMQYHPE-----------
RKRPGL-LHNVVDCSQEELFGDLLA--DGLMDTETAEQMFLDKYPVPELPIYLNSKYMTQ
IVGEINQPSG----SGPPSSLNNNDLNHII----PHVNLQHLLTSS---IREEMISVACT
TRYEGKFLTQILYTPCFYENLKSGENNELK
>CAGL0F03047g
--M---------------------------------------------------------
------------------------------------------------------------
HSLFKEDYSV-----------------------------TKEASEPE-------------
------------ADESIDVNMAGLSLTSS-------------MGDGSA------------
---LHISSPG-PSNATVQTIKRE-----------------------VTHGDESPQGDSDD
INAQHSRAMSEHRPSIVALKMSLKEVAEAAAAKRKNLPFRTINNVMDSQRSSISSSRDEI
FVDASPSPVVT------------------RTA----SIDIPRSEDGRRS--------SNR
LVNSKPYLY---------------------------------------------------
------------------------------------------------------------
------------NYEPSGVPVGDPDGGMLQ-GTDVVLNQE--------------------
-LLEQALKRDMKRKRADTMQSSTVELNKKV------------------DTNTSKNSNHTE
IMKNPPETAEPTS------------------ATAAMMMRLYGDRTLLNQQITKQKED---
------ENKYSHTITNAAYKKLKPFSGVKRKILSNPNLNLQPLEPI-------------R
PNEPPTSGQRTPNNSAHVHSE----------------SPSPDRTNVILKWRDSQNQSNNK
ELK-VYLVSNEICASLKNDD-KLFAEGKLLATDNSQFNKIPLSYDSHNNEWYVPDLYLPQ
GIYRLQFLVNG-NLVHSDFLPTATDDQGNIMNWFEVLRGYDRIEPYRDESEIQSDYTSSV
DTTLEGMENNGFQGSSDNSTTSMRNNNPVALNLQAPAP-----SKAQASRNSSYYS----
AKSFEKSITQFSDYTGV-SRTNSM--VSAVSPINNANTRDNDLE----------------
-FFPPIKP-KVYEYSNNIPALFR---ISCDMEDVDDDNGTENN----PRAF---------
YDRPSF-TNRVVDCNQDALFGDLQK--GGKMDAEEAENLFLKKYQVPDLPVYLNSTYLNK
IFHEFHQVAG----PS--T--QDSSINHII----PHVNLKHLLTSS---IRDGIVSVACT
TRYAGKFITQVIYAPCGNDQLESKE-----
>NDAI0H01600
--MGNNPSTTD---------SENTAADLQEKKAGFHNKHLTRIQKQESPKERKGSITSHL
FSSKGSSKRHALMPK----------PIEAQGNIKSHN-----------------------
--VFKKDYSMDEPL----------------------TNKGGIKNNDF-------------
------------NDENIHETMASLSLVTS-----------SDNERKKS------------
---MSFARPG-PSTPTVQPTKHD-----------------------ITSLEGSTDVNTGI
DNMNVAGDLNSHRPSIVALKNTLAESSIHPPS---------------DLSKTVSTSSNCQ
SFSTESSSSAL------------------HKTE---SIDIPRRHSQGFNENYNETMLKHP
TVHSYQYQYFNNENTNN-------------------------------------------
------------------------------------------------------------
-DGGLHKHKENFNDMQLSTSNDDEESGVLQ-SADIVVNQS--------------------
-TLQNALKRDMKRKRTDTISTNKSGAPTSD-----------------------ALKAKDE
PEAKTKTEKPAMS------------------ATAAMMLKLYGDTTLKEKETFKNNTISGT
IRYDDFYKRSESSVNLPENKKLKSFDNNTKNGNGYVSVSGNPNSGLSNTYNSNSNLSFSS
SPRDIKIQHIDDVKTHLPSSFSSSTSSTSSSLGSSAGLI-NDNVHVVLKWRDQID--NPK
KCK-IAIISDDIVNALESSS-----SKRKSNTNNNDNNTLPMVFNPMIKEWYMPNLTLPP
GIYRLKFSINN-DITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPYRD------------
EIIETTFHTAP-------SQGTLSVHDL---------------TMIRSRRSSSFVS----
AKSDLSSFTPYSDYAGI-SRSSSSVGTATKKASLVSLRGTNKLD----------------
-LFTPIEP-KKIAYSKEIPELFK---IANSEDTNKMEIDDDGS----SP-----------
FERPSF-THKVIDCNQDKLFADLQR--DGNIDAETAEALFLNRYPIPDLPIYLNSTYLNK
IFTQFQKQHNDPTLPA--S--SSIGLTHII----PHVNLNHLLTSS---IRDEIISVACT
TRYQGKFITQVMYAPCNYSSQENKAIS---
>NCAS0F01090
MDMGNNPSSSE--------HTQKDKEEEEEEEAIKDTIILHNKHLDHLQDERKGSISSNL
FTNKNSSKRHAT-------------SIMSQSKVTNDN-----------------IQNPPE
TVFFKKGYSISRSMQDD-------------------SDIKTEGQATV-------------
------------DSENIHEPMASLSLKTS----------MENDENRKS------------
---FSFMSPG-PANPTVEQTKHD-------------------------------------
--VTNKENSFEHRPSIVTLKQTLSGTKVTNDN---------------NIDKLNKTISSSS
NSQSVSTASSS------------------SIANRTGSIDIPKENRYNFKDAMDTIP-KQH
SVHAYQHDYFTINDENARNG----------------------------------------
------------------------------------------------------------
------------SDGRLSTSGDNSEPGVLQ-NVDIVLNQS--------------------
-FLKDAMKRDMKRKRTDTGASTA-----------------------------------TP
DIEKPTEKKKPIS------------------ATAAMMLKLYGDKNQMEKEEKKSSGSYSY
------ADQYEHSTSQINLREVKKIKHIENDFVEDNFGI--------------------S
SPKEIKIQHIDDVKNAPPSSL--SSSMSSSSFGPSSDEQTNDNVQVVLKWRDQID--NPK
HCK-ISIVSDDISSAIPAKA--------------TKAGKLPMLFNPMIKEWYVPNLLLPP
GIYRLKFSING-DLTHSNFLPTATDSMGNIVNWFEVLPGYDTVEPYRD------------
EIIETTFHTNG-------SQGTLRDNNP---------------TTIRSRRSSSFVS----
ANGDLASMTPYSDYTGI-SRSNSA--LNSKRTSLVSLRGVGKLD----------------
-LFTPMEP-KKIEYSNEIPELFK---ISNSIEDEDDDEGDYGHNETLSP-----------
FEEPSF-TNRVVDCNQDKLFSDLQK--NGNIDAETAEMLFLNKYQVPDLPIYLNSSYLNK
IFLQFQKQHNDPTPSA--NTASTIGITHII----PHVNLNHLLTSS---IRDEIISVACT
TRYQGKFITQVMYAPCNYGNPEIKSS----
>ZYRO0D12562g
--MGNTPSAHQ--------RVGRKGSENFQESNNSSNRYSQTKYLLEVDKGRQSSITSQL
FPSRKTRHA------------------PSGLGNLKRK---------------TQNVVPHP
PSLFKKNYSLEEASAGAQGPNNNNNDNHNVTLMAADDDPRDFNDTKT-------------
------------STESVRENMAGLSIKSS---------------NETG------------
---PMFFSPG-PATPTVQPTKEE----------------------AIPPMDDNMI-----
---------FHNRQSVVALKKNLEESEQPSSR---------------SGS-SANMETRTT
PIDNRRLKPLP------------------RQ-----AVAAAITATAT----------TAP
ATPNGR------------------------------------------------------
------------------------------------------------------------
-PSID-------TDPESSDIDNISDDGYLH-SKDIVLNQS--------------------
-LLHNVIKRDMKRKRDKETNDSNNNLVATKTLEQDGGTN---------NTSTNAFISKNS
TLEPLGNHGNP---------------------------KVHDVTINLESESPRGQSGLS-
------YDSLELG-HLQDVKKLKSIPHDMIMPHASAVGKIRPEVLQ-------------Q
HGKFYSMDSFEKGSVEHREVEDRNRNSSLSSLSSSPVSGSSQDVHVAIKWRDHLP--VDG
TNR-MSMVSEDIASTLSFER-----------QKHGARNTFPMRYEEETKEWVVPDLVLPV
GVYRLQFLING-ELTHSNYLPTATDSVGNFVNWFEVIPGYEKVEPYRD----EVELDSGQ
PLNAGNNGIAG-------SVLSLENQGSEGTVLMEPVPGKVNVRPPLASMHHSSNR----
---VIRSNTPYSDYTGI-SRSSSA-----LRKSPINCT-TSSLD----------------
-LHTALQP-KKYKYSNEIPELFKTAPITKANDENEDFTFGHME----PPTYD--WARGHP
SSNAGF-GNQVVDCNQDELFTELQQ--GGLLDAETAEQLFLEKYPVPDLPIYLNSYYLNR
IISEFQKNNY----PG--G--GSGGINHII----PHVNLNHLLTSS---IRDEMISVGCT
TRYEGKFITQVIYAPCYYENGRTLH-----
>Suva_2.599
--MGNSPSTQD------PSHSAKKDHSHHL-----------HE---AFNKDRQGSITSQL
FNNRKSIHKRHSSHANYDN-----AAIPPRMQLLASQPSTSSTSDCDDSTNNDVSAASEP
SPLFKKDYSV--------------------------AKAADDNETTL-------------
------------ANLSLYDRHDASAPEEQ----------------VKS------------
---PTFLSPG-PSMATVKQTKNYPD--------------------DLSTVNNTIVDETIG
DERKDHPHHERHRSSIIALKKTLLENSATASP---------------SPT-------RSS
SIHSTSLLPLS------------------KAG----SIDIPIKQTYS----------KKP
SVHAYQYQYLDPDP----------------------------------------------
--------------------------------------------------------T--L
SDDSQ-------LDKESKSDNIDAEAGVLQ-SEDMVLNQS--------------------
-LLQNALKKDIQRLS--RVNSSNSTYTIDSATHNNNNNNNNNSNSNNSSNSENNIGYKEN
SSDSNDDSGAPIS------------------ATAKMMMKLYGDKTLMERDLNKHQNKSL-
------KKVQNKKLRSASNSRRSSFASLHSLQPRKSVLTNSLNLQP-------------L
HPLHPIINDNDSQYSVPQHREIPHHYNSMSSMSSISSTNSSESTLVILKWKNNSN--MPA
TTE-VSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAVHKEWFVPELFLPP
GIYRLQFSING-ILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRD------------
----EADTESQ-------VGSTIDVEAP-----IRPEPK----RLSSSSRKSSYYS----
AKGVERPSTPFSDYRGL-SRSNSA----NLRDSFVRLK-ASSLD----------------
-LMAQIKP-EILEYSNEIPSLFT---IGNGSATPIQEDLPS-------------------
QDLPSF-THKVVDCNQDDLFATLQQ--GGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNK
ILNQGNPNSE----SG--DK-DEGAINHII----PHVNLNHLLTSS---IRDEIISVACT
TRYEGKFITQVIYAPCYYKTQKAHGNK---
>YDR422C
--MGNSPSTQD------PSHSTKKEHGHHF-----------HD---AFNKDRQGSITSQL
FNNRKSTHKRRASHTSEHN-----GAIPPRMQLLASH---DPSTDCDGRMSSDTTIDKGP
SHLFKKDYSL--------------------------SSAADVNDTTL-------------
------------ANLTLSDDHDVGAPEEQ----------------VKS------------
---PSFLSPG-PSMATVKRTKSDLD--------------------DLSTLNYTMVDETTE
NERNDKPHHERHRSSIIALKKNLLESSATASP---------------SPT-------RSS
SVHSASLPALT------------------KTD----SIDIPVRQPYS----------KKP
SIHAYQYQYLNNDE----------------------------------------------
--------------------------------------------------------T--F
SENSQ-------MDKEGNSDSVDAEAGVLQ-SEDMVLNQS--------------------
-LLQNALKKDMQRLS--RVNSSNSMYTAERISHANNN-----------GNIENNTRNKGN
AGGSNDDFTAPIS------------------ATAKMMMKLYGDKTLMERDLNKHHNKT--
------KKAQNKKIRSVSNSRRSSFASLHSLQSRKSILTNGLNLQP-------------L
HPLHPIINDNESQYSAPQHREISHHSNSMSSMSSISSTNSTENTLVVLKWKDDGT--VAA
TTE-VFIVSTDIASALKEQRELTLDENASLDSEKQLNPRIRMVYDDVHKEWFVPDLFLPA
GIYRLQFSING-ILTHSNFLPTATDSEGNFVNWFEVLPGYHTIEPFRN------------
----EADIDSQ-------VEPTLDEELP-----KRPELK----RFPSSSRKSSYYS----
AKGVERPSTPFSDYRGL-SRSSSI----NMRDSFVRLK-ASSLD----------------
-LMAEVKP-ERLVYSNEIPNLFN---IGDGSTISVKGDSDDVH----P------------
QEPPSF-THRVVDCNQDDLFATLQQ--GGNIDAETAEAVFLSRYPVPDLPIYLNSSYLNR
ILNQSNQNSE----SH--ER-DEGAINHII----PHVNLNHLLTSS---IRDEIISVACT
TRYEGKFITQVVYAPCYYKTQKSQISN---
>Skud_4.696
--MGNSPSTQD------PSHSSKRNHGYHL-----------HE---AFNKDRQGSITSQL
FNNKKSVHKRHTSHASSHK-----AAIPHRMQLLASH---DVASDCDSSVNNDTIIDKEP
SPLFKKDYSL--------------------------ANAADENDTTL-------------
------------ANLSLNDDHDGSAPEEQ----------------VKS------------
---PSFLSPG-PSMATVKQTKSDLD--------------------DLSTVNCTVVDETME
NERSGHPHHERHRSSIIALKKTLMENSATASP---------------SPT-------RSS
SVHSASLPPLT------------------KTG----SIDIPVKQTYS----------KKP
SVHAYQYQYLSPDP----------------------------------------------
--------------------------------------------------------T--F
SGNSH-------TGKEANGDNIDAEAGVLQ-SEDMVLNQS--------------------
-LLQNALKKDMQRLS--RANSSNSTYTMGRENRINN--------------SESNIDGKEN
SIDPSDDSTVPIS------------------ATAKMMMKLYGDKTLMERDLNKHQNKT--
------KKAQNKKLRSASNSRRSSFASLHSLQSKKSILTNGLNLQP-------------L
HPLHPIINDNESQYSAPQHREISHHSNSISSMSSISSTNSTENTLVVLKWKSDTN--MTA
TTE-VSIVSNDIASALKEQREVNLDDDASLDSEKPLNSRIRMIYDSVHREWFVPDLFLPA
GIYRLQFSING-LLTHSNFLPTATDSEGNFVNWFEVLPGYHTIEPFRD------------
----EADMDFQ-------MRSTLDEEAP-----IRPEP-----KRLSSSRKSSYYS----
AKDGERPGTPFSDYRGL-SRSNSV----FLRGSFVRLK-ASSLD----------------
-LMAEIKP-EKLEYSNEIPNLFN---IGEASTTTSKDHFERLS----P------------
QDRPSF-THKVVDCNQDDLFATLQQ--GGNIDAETAEAVFLSRYPIPDLPIYLNSSYLNR
ILNQSNPNSE----FH--DG-DEGGINHII----PHVNLNHLLTSS---IRDEIISVACT
TRYEGKFITQVIYAPCYYKTQKAGGNN---
>Smik_4.697
--MGNSPSTQD------PSHSTKKEHGYHF-----------HE---TFNKDRQGSITSQL
FNNRKSIHKRHVSHTSGHN-----GTIPSRMQLLASH---DSVTDCDDSVNDDTTIDKEP
SLLFKKDYSL--------------------------NNTADGNDTTL-------------
------------ANLSLIDDHDVGAPEEQ----------------VKS------------
---PSFLSPG-PSMATVKQTKSDLE--------------------NLSTSNYTTVDEATE
DGRTNHPRHERHRSSIIALKKTLLENSATASP---------------SPT-------RSS
SVHSASMPPLT------------------KMD----SIDTPLKPAYS----------KKP
SIHAYQYQYLSPDP----------------------------------------------
--------------------------------------------------------T--F
SGNSQ-------AGKEKNSDNIDAEAGVLQ-SEDMVLNQS--------------------
-LLQNALKKDMQRLS--RANSSNSTCTIENSNNNNNY-----------SSSENNIRNKED
SGSFNDNSNVPIS------------------ATAKMMMKLYGDKTLMERDLNKHQTKT--
------KKVQNKKLKSVSNSRRSSFASLHSLQSKKSILTNSLNLQP-------------L
HPLHPIINDNESQYSAPQHREMSHPSNSMSSMSSISSTNSAESTLVILKWKNYSN--MAV
TTE-VSIVSNDIASALKEQREVDADESASLDSEKQLNPRIRMVYDNVHKEWFFPDLFLPP
GIYRLQFSING-LLTHSNYLPTATDSEGNFVNWFEVLPGYHTIEPFRN------------
----EADLGSQ-------VEPVLEEESP-----IRPELK----RFSSSSRKSSYYS----
AKGVERPSTPFSDYRGL-SRSSSV----NMRDSFVRLK-ASSLD----------------
-LMAEIKP-EKLEYSNEIPNLFN---IADGGTTSVIRESRDSS----P------------
QEQPSF-TYKVVDCNQDDLFATLQQ--GGNIDAETAETVFLSRYPIPDLPIYLNSSYLNK
ILNQSNPNSE----PH--DR-DEGAINHII----PHVNLNHLLTSS---IRDEIISVACT
TRYEGKFITQVIYAPCYYKTQKARGNNEN-
>Ecym_4065
--MGNTTSSTDWGYQKVGRYQQQQQQRRQQRQGVGGEAKGGSVQHGTKERVRQQSITSQL
FPGRHQARS----------------KWKSQRNVAPGA----------------VSGVGGV
DHLFKRDYSLSDDSSA--------------------VGMEGVQEEGG-------------
------------VDLIGMPNVAGLKLDSR------------------A------------
---QAIMSPG-PSSATVEHSKLE-------------------------------------
ASISPELAAQVHRPSIVALKQNLIQGHMGHPL---------------HSPLRDDYDGDDD
DGDTAPSSSYV------------------PSA----TIDIPYSNPSTMN--------TLS
IIAQHQEDYS--------------------------------------------------
------------------------------------------------------------
------------TRSSAVSISTQDLDGYIE-NSDVVLSEA--------------------
-LVDSVVKNDMRRKRQLQKQSAEASEAINE------------------------NKNEAN
QQPDVKKAKVPMS-------------------------NLLKPSKQM-------------
------GTVTGTFLPQSELKDSGSFE---------------------------------Y
GSVQHVEVAADDNYSDDC----------------------PERVQVIIKWRDTNV--DPR
TSK-ISIISSDIASVVQPTR---------------KRKKIPMVYLEQEQCWAAEDLKLPA
GIYKLMFFING-QVRHSNYLPTATDSLSNIVNWFEVVPGYDQIEPYRD--------AAIE
RSPNELAAYNE-------TSLLLTNETP------SPANI----RPPLINRGTSSSS-R--
ARVIERTNTPISDYTGVLARNSCS------NPAIYRHK-SNNST----------------
-DVDILPKQPTLIYSSDVPELFK---VGNASTGGSQQGSDKNKLQNPSKYL---------
QDSPNF-MKNVQDCNQDELFHYLQE--KWNMNAQEAEEVFLEKYSVPDLPIYLNSTSLNE
IFNKLQQNSA----MG--DLPKRKSLTHII----PHVNLNHLLTSN---IRDEIISVGCT
TRYEGKFITQIMYAPCYYENYE--------
>TDEL0A03910
--MGNSPSVQE---------HQQQPHGVLDANHPFRRAQLGNE----MNSGRQQSITSQL
FPSRNTRHVG-----------------PHSMNAKRNR-----------------HPHPQP
PSLFKSDYSLR-------------------------STAEETPANTG-------------
------------STENIRDNMAGLSLKSS-------------NENAQV------------
---PSFLTPG-HSTPTVQPTRQA----------------------AVPAADLKNKLQNGL
NQQKEISSHRFQRPSVVALKKTLLDDGELHST---------------SSRSTSGDVVSSA
SLDIYSAL----------------------------NLDSPTQSGSK-------------
---AKDTD----------------------------------------------------
------------------------------------------------------------
------------ADPDTSDFDDISDDGYLQ-SEDVVLNQS--------------------
-LLQNVLRRDMKRKRPAKKSKVPNTSHVSNL-----------------KASSNSVSYESL
ENGNVPDAKKLKS-------------------------LSYDGSLPSFQPTAQNNDRLN-
------GLAHDNGFNRIDSFEKGSVEHREVET---------------------------S
PTMRNSSSASPSSSSIISNTE-------------------PEKVHVILKWRDQIE--DPS
KCK-ITIISTDIASALNFDP-----------SDKSFHGTFSMKYDEKENNFYVPNLSLPP
GIYKFQFVING-EIRHSNLLPSATDSVGNIVNWFEVIPGYESVEPFRNEIDYHENMGIDP
PQSDSSTSTGK-------HHDESPGKVP----LVQPVPG----RPPLAARHTSSYS----
-NKQERSGTPYSDYTGV-SRCNSA----VRKSPLIHQT-LSSID----------------
-LVTALQP-KKYEYSNEIPELFK---AGNVLGQSDENQFPTPP----PP-----PMNPPS
YDQPSF-LENVVDCNQDNLFVSLQQ--GGLLDAETAEQLFLEKYTVPDLPVYLNSTYLNK
IFNEFQKHNS----LG--S--NSSGLNHII----PHVNLNHLLTSS---IRDEMISVGCT
TRYEGKFITQVVYAPCYYASGPKAEGKK--
>ADR194C
--MGNTVSSTE--------GSKRRGDGRAGTPAASGASQWETD---STDRGRQQSITSQL
FSGRHHARS----------------KWKFQGAGDSAT-----------------GSSGGI
ASMFKCDYTLN-------------------------ADARSISSEQG-------------
------------ETCQGMPNLAGLVLDAC------------------T------------
---QGIRSPG-PSTATVEHTNLE-------------------------------------
ASMSPELASQTHRPSISALKQSLIQVQGQTNS-----------------------RHRAE
DIDTAQYVPSA-------------------------TIDIPCSNPST----------NTA
SVTHRADDSS--------------------------------------------------
------------------------------------------------------------
------------TRSSLLSLFTQDVEEYIE-ASEVVLNES--------------------
-LVDSVVRKDLRRKRQLQQQCGATRAAEQA--------------------------AETA
KQPDAKKKKLPCS-----------------------------------------------
-----------------------------------------------------------A
AALSATASGVVQSETEEQHSD-----------------AEAEFVEVIIKWRDCLL--DPQ
RTK-LSIVSPDIASVIHKNS----------------KRKVAMVFSKDEQFWVAPDLRLPP
GIYKLQFLING-ALRHSNFLPTATDSHSNIVNWFEVVPWYDRAEPYRD------------
PAPEE---------------VAMPPESP---QLTAPAAG----RPPLLKRGTSSSS-R--
ARVVERSNTPISDYTGI-SRSGSA------RPLLAHHK-SANSI----------------
-ELSPIPR-CVLQYSTEIPELFK----------------PEGC----PP--------DPN
TAPGSF-NENIQDCNQDELFRFLQE--DWKMSAQEAEEVLVEKYPVPDLPVYLNSSYLNE
IFTKLQRSSV----TG--DV-KRSSFTHII----PHVNLNHLLTSS---IRDEIISVGCT
TRYEGKFITQIMYAPCYYESSRK-------
>SAKL0G04928g
--MGNTASTVN--------LQEKRHHSHL------------------LPRDRQHSITSQL
FPGRNTRNAQDDSPVSAAAAAAAPGKWKRRLSLNHAP-----------------AVVSTP
SPLFKPNYSMNESSNASIAGLGSNYTTSSQEDLNKLQAVDSSRKNTLSSIESNSASSKPA
PPLLNPTNVSADDSSQLRDHLAGLTIHSEGLSRNVSNAVSRSSYDSSATPNPATNYVSSP
RVYPFPLSPG-PASPTVEPTRHE---------------------AELLPTRSEVDGEAEN
DRYRDQFPSYLHRPSIVALKRSLVEGRIGSKL---------------HVQTSNGDTTNAS
SSTAGSLKNYILDDNNRILLPSQLIDDDRQDSGRTDSIDIPGRGHAA----------TAT
IGSNRDTTALSDDQDTS-------------------------------------------
------------------------------------------------------------
------------LSPGSPVSQLDLSEGFLE-DNDVLLNNA--------------------
-VLESAIRKDMKRKRQEKKRPEDQEKSFSSSLESAE------------PSAISGVKKLKP
LTPNEQERQRQVG-------------------------EDYKNFLPSFQPIRTGATPKL-
------FQVSGNG-GRIDSFELGTVEHFESIGDDHRTVSGGSNAPN-------------G
GGKTTSMRANKEAEEEEEEEA-----------AAGARYGEDDLVNVVLKWRDCIV--DPK
TCK-ISVISSDISAVLALQS----------------SKKIPMEYETTEKSWFVPNLKLPP
GVYKLQFLING-ELRHSNFLPTATDSFGNFVNWFEVLPGYYEIEPLRDVPVDSMNYGSDL
GVSMKESVNGG-------SDFTITAPIP---------------RPPLLSQATSSSYRS--
SKYIERSTTPYSDYTGILSRSNSA------RPLLNQKK-SSSYD----------------
-VFAPLPP-KKYEYSTDIPELFK-----VNDEEDHDHDIPEDP----PSYSS--LLKGSE
AEQPSF-HCRVQDCNQDRLFSDLQQ--HDRIDAQAAEEFFLQKYPVPDLPIYLNSSYLNK
VFNQLQKDNN----AG--E--TKAVVNPVI----PHVNLNHLLTSS---IREEIISVGCT
TRYEGKFITHVVYAPCYYENTNRKEELV--
>KLTH0G03762g
--MGNNPSTAN--------MQNKRVSQLAQ-----------------EPRGRQDSITSQL
FPSRTSGRNPESKV-----------GWKSRVLHGNRP-------------SASPASTPPV
QSPFRKNYTLEVTTESAPYNLKKSISGNPAPPM---CTTTHASADES-------------
------------SSSSLRDHLAELSLQNSESQPNRKTSPGLGPAPAPA------------
---PVLRSPG-PSTPVVKYTKHD-------------------------------------
-------AISDQISSITSLKKMLVEGRVGDNI----------------------------
------HPPPT-------------------------SIDIPRRPSAA-------------
------------------------------------------------------------
------------------------------------------------------------
------------LSDAYFSDDGDDEESLLQGTNDVVINNS--------------------
-VLENAMKRKRGTKKNKGVGASSESHE---------------------HISYPGLKKLKP
LEHGGDKRDLP----------------------------HFRAMHPRPSEDNVGPDSAAI
------PRLITDSLNRIDSFEKGTVEHYEGANESG------------------------F
SSQNLTSSDMRDSDDADEDRG--------------------PGTHVILNWKDNIV--DPK
TCK-MSIVSKDISSTLNPHK---------------KFSKIPMVFDMERNCWTAHDLYLPS
GVYKFQFLING-ELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRD------------
VISSEDVKLSK-------DQIAVEQPAP----------E----RPALGSDGSSSSNWKGS
SRHVERSGTPFSDYTGLCSRSELT------KPELRHNN-TSSYD----------------
-LLAPVPR-PKYEYTDEIPELFK-----------ANFDGSLVP----PPYEERELTKDGS
QKPPSF-LHRVQDCNQDVLFADLQQ--NGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNA
VFSGFQDKTD-----------SKTRVNHIV----PHVNLNHLLTSS---IRDEIISVGCT
TRYEGKFITQIIYTPCYYSNKDGAH-----
>Kwal_47.18642
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------MVFDMESNCWIAPDLYLPA
GVYKFQFLING-ELRHSEFLPTATDSFGNCVNWFEVVAGHKVIEPSRD------------
-VISNDFTENQ-------V--AISANDP------SASP-----RPPILSGSSSFSNWKNS
AKHIERSGTPYSDYTGLCSRTDLA------KPELRHKN-TSSYD----------------
-LLAPVPR-PVYEYSNEIPELFK-----------ANFEGSSTP----PPYQESVPSQNPV
KNQPSF-LHRVQDCNQDVLFADLQK--NGEIDSQAAEEAFLQQYPTPDLPVYLDSSFLNA
VFRGFQEKND-----------TKSKLNHIV----PHVNLNHLLTSS---IRDEIISVGCT
TRYEGKFITQIIYTPCYYGNKEKSG-----