MUSCLE (3.8) multiple sequence alignment

Kpol_1045.81      MLLFSII-RLILLTFALCQATEIPEIRLRAVDTVTSRVES--LNISWFQKTFVKLFAIAS
TPHA0J00240       MLLVPLIATLVSPILVHSTVLEPVDMQLDAVHTVDRRIASAVTAVSNAGSAWLRLAHAVT
                  ***..:*  *:   :. . . *  ::.* ** **  *: *    :*.  .:::.*   .:

Kpol_1045.81      VKDEGNSTNLLETYQSMKDTLFKMVLLSGKTHTKKVIVDLVDTANEVHDKAIDVMSSLHS
TPHA0J00240       FVPTANWT-LEAALDHYANTLAPI----GEKDMVDAVARWSAGAGAGSDRSSDAGA----
                  .   .* * *  : :   :**  :    *:.   ..:.     *.   *.: *. :    

Kpol_1045.81      DPNLSSIEMSLLARPISSYTRRFIEFQHWQLVKMYQNLLHDPN-TPINWWYVSQLFAVVE
TPHA0J00240       --------WTWLTAPIDAATVSLIRLQSWHLRKL---VVDSPEATSETRLQAASSALLVE
                           : *: **.: *  :* :* *:* *:   :: .*: *. ..  .:.   :**

Kpol_1045.81      RSLYANEVSVEMFHSNSYRVVSEILRIAKYLLNTGNSFEQYKVPDETSVKFEIMEDPKKK
TPHA0J00240       QALRARRTVVHMLTS----------RCANSNADGGAAI-----------------SPRRK
                  .:* *. . * *: *          * *:   : * ::                 .*..*

Kpol_1045.81      PNQDQYLLYIRKMMFFMSQGIAIVFFCVAANSIPCIFAFGSLISMSFVIWIFVMIQYMAE
TPHA0J00240       PTPDEYLLYLRKFAFFMAQATIIGAFCMAAGMFSCYFMFAILLPASTAIWISVILQ----
                  *. *:****:**: ***:*.  *  **:**. :.* * *. *:. * .*** *::*    

Kpol_1045.81      FNNRVPTPRPI
TPHA0J00240       FRRGMALP---
                  *.. :. *   

FASTA FORMAT for MUSCLE Version 3.6

>Kpol_1045.81
MLLFSII-RLILLTFALCQATEIPEIRLRAVDTVTSRVES--LNISWFQKTFVKLFAIAS
VKDEGNSTNLLETYQSMKDTLFKMVLLSGKTHTKKVIVDLVDTANEVHDKAIDVMSSLHS
DPNLSSIEMSLLARPISSYTRRFIEFQHWQLVKMYQNLLHDPN-TPINWWYVSQLFAVVE
RSLYANEVSVEMFHSNSYRVVSEILRIAKYLLNTGNSFEQYKVPDETSVKFEIMEDPKKK
PNQDQYLLYIRKMMFFMSQGIAIVFFCVAANSIPCIFAFGSLISMSFVIWIFVMIQYMAE
FNNRVPTPRPI
>TPHA0J00240
MLLVPLIATLVSPILVHSTVLEPVDMQLDAVHTVDRRIASAVTAVSNAGSAWLRLAHAVT
FVPTANWT-LEAALDHYANTLAPI----GEKDMVDAVARWSAGAGAGSDRSSDAGA----
--------WTWLTAPIDAATVSLIRLQSWHLRKL---VVDSPEATSETRLQAASSALLVE
QALRARRTVVHMLTS----------RCANSNADGGAAI-----------------SPRRK
PTPDEYLLYLRKFAFFMAQATIIGAFCMAAGMFSCYFMFAILLPASTAIWISVILQ----
FRRGMALP---