MUSCLE (3.8) multiple sequence alignment

KLLA0F07359g       MRTQCVGTTQKGSQCRLKAIEGEKFCRHHSTQNNGTSIATKAPHMPHDAPECVGTTRKGS
TBLA0B09180        ------------------------------------------------------------
ADR266W            --------------------------------------------------------MVTQ
KAFR0F02900        ------------------------------------------------------------
SAKL0E05412g       ------------------------------------------------------------
KLTH0H15796g       ------------------------------------------------------------
Kwal_34.15812      ------------------------------------------------------------
KNAG0A05810        ------------------------------------------------------------
TPHA0G02020        ------------------------------------------------------------
Kpol_1032.66       ------------------------------------------------------------
NCAS0B05780        ------------------------------------------------------------
NDAI0B03090        ------------------------------------------------------------
CAGL0L06996g       ------------------------------------------------------------
YPL034W            ------------------------------------------------------------
Smik_16.200        ------------------------------------------------------------
Suva_16.281        ------------------------------------------------------------
Skud_16.247        ------------------------------------------------------------
ZYRO0A08140g       ------------------------------------------------------------
TDEL0G03080        ------------------------------------------------------------
                                                                               

KLLA0F07359g       KCKLKAIEGGKFCRHHINQNNGTSSPTKTPYIPEDTPEYIYIYTYATLHENAV-VEKKNR
TBLA0B09180        -MTKTKVKDGAKYCHLHNPSTSPTKSKPSPGKPINPVGYIYVYTYEELYNSRI----SSK
ADR266W            QCAGTTAKKDRCKRRVANGVYCAAHRAQHSAAPVQSDGFIYMYTYERLY-DAL-MGKGGA
KAFR0F02900        -----------------------------------------------MF-DSL-IAG-SH
SAKL0E05412g       ------------------------------------------------------------
KLTH0H15796g       -----------------------------------------------MY-DSI-TVQ-QQ
Kwal_34.15812      -------------------------MPPKQPTSRKTPGFIYIYTYKQMY-ESL-VTK-RV
KNAG0A05810        ------------------------------------------------------------
TPHA0G02020        --------MIPPSGQGAPVAKIDRYSNKKPDYELKKTGYIYMYTYERFY-NSY-VNK-DL
Kpol_1032.66       -----------------------------------------MYTYKEMYEVMLESENHND
NCAS0B05780        -------------------------------------------MYEAYLEGDL------R
NDAI0B03090        ------------------------------------------------------------
CAGL0L06996g       ------------------------------------------------------------
YPL034W            ------------------------------------------------------------
Smik_16.200        ------------------------------------------------------------
Suva_16.281        ------------------------------------------------------------
Skud_16.247        ------------------------------------------------------------
ZYRO0A08140g       -----------------------------------------------MY-HSL-VTR-SV
TDEL0G03080        ------------------------------------------------------------
                                                                               

KLLA0F07359g       KEITWLVTDNSKMKPSKNQALILRNNRFDPWQHNKDEILIKIGMTRRSDVSKRINEWQKQ
TBLA0B09180        TQPTWLGVQTLENHSQT-------------TQVPDAQILVKLGVTTQTKVETRLHQWERQ
ADR266W            ASLDWLKADRSVLEKKP--------VALQRWQLD-GDILVKIGMTNNP-VAARLVQWRQR
KAFR0F02900        KKLNWIMVDNSIIDPKN--------VRKDKWEID-GHILCKVGMTTKKDVKLRLSEWKKQ
SAKL0E05412g       -------------------------------------------MTTKPCVSIRLAEWRGS
KLTH0H15796g       DQLKWLHMDYSILEKKE-------TLPLSKWSAT-DQILCKVGMTRKPTVSARLLEWENT
Kwal_34.15812      DHLKWLHMDYSILRNEK-------TLPLSKWSAP-GQILCKVGMTRKPTVLARLLEWQNS
KNAG0A05810        -------------------------------------------MTTKRNVQLRLDEWRNL
TPHA0G02020        NDIDWLYVDESVINNGK-------TSKLSNWEDN-SKILCKIGMTTTS-VEKRLSEWRNV
Kpol_1032.66       SKLQWLFIDESKISKGK---------ELENWSNN-RNILCKIGMTTNK-VPIRLNAWERS
NCAS0B05780        KLQTWLYQDNSIIIKEG-------ARKKEIWKAP-DTILIKIGMTRKTDVKVRFKEWMVS
NDAI0B03090        -----------MKKTHR---------EQKSWNSP-DTILVKIGMTTKKNVALRLQEWEKT
CAGL0L06996g       -------------------------------------------MTTKPMVSTRLLEWQNT
YPL034W            -------------------------------------------MTTRKTVDSRLLEWQTT
Smik_16.200        -------------------------------------------MTRRKTVDSRLSEWQNT
Suva_16.281        -------------------------------------------MTRRKTVDSRLLEWQNT
Skud_16.247        -------------------------------------------MTRRETVDLRLLEWQNT
ZYRO0A08140g       ADIDWLYLDESILSARG---------KRRHWSSN-DQILCKIGMTTRSSVNTRLLEWQNT
TDEL0G03080        -------------------------------------------MTTKSKVSTRLLEWENS
                                                              :*    *  *:  *   

KLLA0F07359g       CKRDIILITPEIVRQWI-----VSSTTKPKSIN-------SMSNVIQKLCRLALNNHSNI
TBLA0B09180        CGKPIVNLTPTKVQELLDCYTTTTSNSTTKQSK------QKSNSLTQMLRRLTLNPSTRN
ADR266W            CTHPLVALTPARVRELQ------RVHARRKRGV--------LERLQERMRDLSLHR----
KAFR0F02900        CTFDVINLTPANIDLLL-----DAQNTKSSSGK--------TDSLSTLMSKLSLNKKKNK
SAKL0E05412g       CKHEIIGLTPKLIEKLY--------NSTNRDNE--------ISRLTKFFNKLSISKKKPG
KLTH0H15796g       CKHPVTGLSPSSIQALA------AAQQPSKPPE---------KSLVKLFRKLSINLKSKT
Kwal_34.15812      CKHPIVAVEPSMVEELC----KLKLQSSPTEDK----------TLSMLFRKLSLKGKKEI
KNAG0A05810        CNHELLNLTPQAIAKLT-----ETYTSTNESDV---------TMLTRWMKRFSLSGEGKK
TPHA0G02020        CKHDILNLSPERIGNLQSCYVNKTKKIKNDGSK------KSIKKLADIFSALSIKNNKNS
Kpol_1032.66       CKHEVINLTPENIQTLLAKQTKLMLQAKPKPTVKNSTWPISMKQMISLFTKMKLKDSKPQ
NCAS0B05780        CHHEIIGLTPENMEMLL----KEHHIGFKKKDN--------VNTITHLFKKLSLKKASRA
NDAI0B03090        CQHPVINLSPERVRNLL--SGREEFMNNDKSDV---------KTLTKWMKKLSLHKKDSK
CAGL0L06996g       CKNPVINLTPDRIEQLI-----YAYDTKTKKIN----------SISTLLTKLELKKEK--
YPL034W            CKHPVINLTPEKVDKLY----HLKLKSESKNISSNRLLPISLSSLQKKMEKLFIKDKSHS
Smik_16.200        CKHPIINLTPEKVDKLY----QLKMKCKNKNIRSNKHLPITLSSLQKKMEKLFIKDKGNS
Suva_16.281        CKHPIINLTPEKVDKLY----QLKMKSKTKNERPKKGLHISLSNLQKKMEKLFIDDKYDS
Skud_16.247        CKHPIINLTPEKVNKLY----QLKLKSTNKNTRSNKVLSISLSNLQKKMEKLFIKDKNHL
ZYRO0A08140g       CKHPVINLTPERIHLLY---------ESGRNSR----------TLTKILSKLSLN-----
TDEL0G03080        CKHPVLNLTPDRVATLC-----------SRNSA---------TGLSRLLSKLFLT-----
                   *   :  : *  :                               :   :  : :      

KLLA0F07359g       VKHTTITSTTI--TDTGRSRNKSDRCFTE-----NGFRCKD-SGH-----VEREIHEWLW
TBLA0B09180        PGKPNRISTGKNLPAELQKRPASLKKLRNFSTTGGGFFTDGTGPAGPVQEVERKLHNELW
ADR266W            -------------PHGADAQEPPLLTFAH-----DGFRCRG----DALAAVEQSIHQALW
KAFR0F02900        AT-----------NKFLTRKAWHLYTYRS-----GGFYTDG-RGELKLPSIENGIHELFR
SAKL0E05412g       -------------RSQLQQVPLELKNFYD-----GGFYYRP-SGKISLSDLEAMTHRILW
KLTH0H15796g       P------------HAVSNSQQLALKCFHN-----GGFYVRD---GNALEDMEARIHRLLW
Kwal_34.15812      H------------RPSAEHQLKGLKCFRN-----GGFYVVD---GSKLEDVEVNIHKLLW
KNAG0A05810        ENSIAS-------EKAREPKGLVLRTYQN-----GGFYIDG-SGSVALQHIEHSIHTSLW
TPHA0G02020        SKEDVISNKT---NQMIPLTNFPFKSYRN-----GGFYSNG-QGNSTVYEIESTIHKYLW
Kpol_1032.66       QQMRI--------QSPSPPIPPNLITYKD-----GGFFHDSKKGTKTLREVEANIHNILW
NCAS0B05780        HG-----------KQKVSIRIQDLYTYKN-----GGFFTDG-NGKLSLEEIENLIHRILW
NDAI0B03090        KVKISA-------EGPIKRQPEILQTYKY-----GGFFHDG-TGHTSLQEIENSIHRLLW
CAGL0L06996g       -------------PQSRQESPLDLLTYKD-----GGFFIDG-TSNLNLSEVENRIHRFLW
YPL034W            HK-----------PSLPDPKVPTLRTYKD-----GGFFISG-KGSMKLPDIESAIHKFLW
Smik_16.200        RI-----------SSFSEHKVSSLCTYKN-----GGYFIDG-KCSMKLPDIESAIHRFMW
Suva_16.281        PK-----------PNYAKVESSSFHTYKD-----GGYFIDG-KGLMKLSDIESAIHRFLW
Skud_16.247        PK-----------PPFLEHKVSKLYTYKD-----GGYFIDG-KGSIRLPDIENAIHRFLW
ZYRO0A08140g       -------------GSKVRPSNPKLQTYNN-----GGFYTNG-KGPKTLAMIENTIHRQLW
TDEL0G03080        -------------PSKPTITTKNLQTYHN-----GGFWVPT----GELPAIEHAIHRHLW
                                                     .*:             :*   *  :.

KLLA0F07359g       KEYGKGNIICEVC-------QKTHREWVKVPIGQMEYIVNTIDRICSDSFSLKRT-----
TBLA0B09180        SLYGRGVVRGCGCGCE-------HTEWFFVPVAELPRVLVLADSVTGRA-----------
ADR266W            RRYERAYVLCSACTRSK--APTRHREWFKVPVRDLGYVLYTIDDLCLGGRAANRPDADTT
KAFR0F02900        KKYGKCYIYCAGCGENR---RTRHCEWFKMPINDLPTIMKSIDDFCLSQSKA--------
SAKL0E05412g       KRYGQGLLYCYGCSVEKHGNPVRHKEWFMVPVTDLPHVMETIDALCSGF-----------
KLTH0H15796g       QRFGQGFIYCHGCRNEK-DHPKRHKEWFMIPISQLPNVFKAIDAICVGK-----------
Kwal_34.15812      RRYGQGFIYCHGCKNEK-GQPTRHKEWFLVPVSQLPDVFKAIDALCVGK-----------
KNAG0A05810        KKYGKGIVHCSGCNPSG---TKKHLEWFYLPINDLPYIFQNIDNFCLKKNGG--------
TPHA0G02020        KRHGKAKVYCYGCDPNG---KKYHTEWFNIPIDDLSHVMKVIDTLCYNNSL---------
Kpol_1032.66       AKYGKALTNCFGCDPNG---NKHHTEWFCVPISELPNVLKTIDSICHRS-----------
NCAS0B05780        KKYGKGIIYCSGCNHT-------HTEWFKIPIKDLPFVIQTIDSLCLAQKA---------
NDAI0B03090        KQYGKGLVYCYGCDPTG---QRRHTEWFNIPIQKLPYVLHTIDSFCLSQNEMVNR-----
CAGL0L06996g       EKYGKGFIYCYGCDPMG---QKRHTEWFHLPIRDLSSVMRTIDAFCYSG-----------
YPL034W            KKYGKGLVYCYGCDPTG---KKRHTEWFNVPVLELPSVLRLIDSYCLGGESR--------
Smik_16.200        KKYGKGLIYCYGCDPTG---KKRHTEWFKVPVLELPSVLRIIDSYCRGEESC--------
Suva_16.281        KKYGKGLVYCYGCDPTG---KKRHTEWFNVPVLELPSVLMIIDSFCRRGEC---------
Skud_16.247        KKYGKGLVYCYGCDPSG---KKRHTEWFNVPVLELPSVLGIIDSFCHEGESP--------
ZYRO0A08140g       QRYGQGLIWCYGCDPEG---HTRHKEWFRVPIKDLPLLARYIDRVCGG------------
TDEL0G03080        QRYGQGLIYCHGCDPSG---KKRHREWFRVPVCDLPWLLTTLDRFCQGLIR---------
                     . .       *          * **. :*: .:  :    *                 

KLLA0F07359g       -------------------
TBLA0B09180        -------------------
ADR266W            KNSTRRAPLAPARPSTQSP
KAFR0F02900        -------------------
SAKL0E05412g       -------------------
KLTH0H15796g       -------------------
Kwal_34.15812      -------------------
KNAG0A05810        -------------------
TPHA0G02020        -------------------
Kpol_1032.66       -------------------
NCAS0B05780        -------------------
NDAI0B03090        -------------------
CAGL0L06996g       -------------------
YPL034W            -------------------
Smik_16.200        -------------------
Suva_16.281        -------------------
Skud_16.247        -------------------
ZYRO0A08140g       -------------------
TDEL0G03080        -------------------
                                      

FASTA FORMAT for MUSCLE Version 3.6

>KLLA0F07359g
MRTQCVGTTQKGSQCRLKAIEGEKFCRHHSTQNNGTSIATKAPHMPHDAPECVGTTRKGS
KCKLKAIEGGKFCRHHINQNNGTSSPTKTPYIPEDTPEYIYIYTYATLHENAV-VEKKNR
KEITWLVTDNSKMKPSKNQALILRNNRFDPWQHNKDEILIKIGMTRRSDVSKRINEWQKQ
CKRDIILITPEIVRQWI-----VSSTTKPKSIN-------SMSNVIQKLCRLALNNHSNI
VKHTTITSTTI--TDTGRSRNKSDRCFTE-----NGFRCKD-SGH-----VEREIHEWLW
KEYGKGNIICEVC-------QKTHREWVKVPIGQMEYIVNTIDRICSDSFSLKRT-----
-------------------
>TBLA0B09180
------------------------------------------------------------
-MTKTKVKDGAKYCHLHNPSTSPTKSKPSPGKPINPVGYIYVYTYEELYNSRI----SSK
TQPTWLGVQTLENHSQT-------------TQVPDAQILVKLGVTTQTKVETRLHQWERQ
CGKPIVNLTPTKVQELLDCYTTTTSNSTTKQSK------QKSNSLTQMLRRLTLNPSTRN
PGKPNRISTGKNLPAELQKRPASLKKLRNFSTTGGGFFTDGTGPAGPVQEVERKLHNELW
SLYGRGVVRGCGCGCE-------HTEWFFVPVAELPRVLVLADSVTGRA-----------
-------------------
>ADR266W
--------------------------------------------------------MVTQ
QCAGTTAKKDRCKRRVANGVYCAAHRAQHSAAPVQSDGFIYMYTYERLY-DAL-MGKGGA
ASLDWLKADRSVLEKKP--------VALQRWQLD-GDILVKIGMTNNP-VAARLVQWRQR
CTHPLVALTPARVRELQ------RVHARRKRGV--------LERLQERMRDLSLHR----
-------------PHGADAQEPPLLTFAH-----DGFRCRG----DALAAVEQSIHQALW
RRYERAYVLCSACTRSK--APTRHREWFKVPVRDLGYVLYTIDDLCLGGRAANRPDADTT
KNSTRRAPLAPARPSTQSP
>KAFR0F02900
------------------------------------------------------------
-----------------------------------------------MF-DSL-IAG-SH
KKLNWIMVDNSIIDPKN--------VRKDKWEID-GHILCKVGMTTKKDVKLRLSEWKKQ
CTFDVINLTPANIDLLL-----DAQNTKSSSGK--------TDSLSTLMSKLSLNKKKNK
AT-----------NKFLTRKAWHLYTYRS-----GGFYTDG-RGELKLPSIENGIHELFR
KKYGKCYIYCAGCGENR---RTRHCEWFKMPINDLPTIMKSIDDFCLSQSKA--------
-------------------
>SAKL0E05412g
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------MTTKPCVSIRLAEWRGS
CKHEIIGLTPKLIEKLY--------NSTNRDNE--------ISRLTKFFNKLSISKKKPG
-------------RSQLQQVPLELKNFYD-----GGFYYRP-SGKISLSDLEAMTHRILW
KRYGQGLLYCYGCSVEKHGNPVRHKEWFMVPVTDLPHVMETIDALCSGF-----------
-------------------
>KLTH0H15796g
------------------------------------------------------------
-----------------------------------------------MY-DSI-TVQ-QQ
DQLKWLHMDYSILEKKE-------TLPLSKWSAT-DQILCKVGMTRKPTVSARLLEWENT
CKHPVTGLSPSSIQALA------AAQQPSKPPE---------KSLVKLFRKLSINLKSKT
P------------HAVSNSQQLALKCFHN-----GGFYVRD---GNALEDMEARIHRLLW
QRFGQGFIYCHGCRNEK-DHPKRHKEWFMIPISQLPNVFKAIDAICVGK-----------
-------------------
>Kwal_34.15812
------------------------------------------------------------
-------------------------MPPKQPTSRKTPGFIYIYTYKQMY-ESL-VTK-RV
DHLKWLHMDYSILRNEK-------TLPLSKWSAP-GQILCKVGMTRKPTVLARLLEWQNS
CKHPIVAVEPSMVEELC----KLKLQSSPTEDK----------TLSMLFRKLSLKGKKEI
H------------RPSAEHQLKGLKCFRN-----GGFYVVD---GSKLEDVEVNIHKLLW
RRYGQGFIYCHGCKNEK-GQPTRHKEWFLVPVSQLPDVFKAIDALCVGK-----------
-------------------
>KNAG0A05810
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------MTTKRNVQLRLDEWRNL
CNHELLNLTPQAIAKLT-----ETYTSTNESDV---------TMLTRWMKRFSLSGEGKK
ENSIAS-------EKAREPKGLVLRTYQN-----GGFYIDG-SGSVALQHIEHSIHTSLW
KKYGKGIVHCSGCNPSG---TKKHLEWFYLPINDLPYIFQNIDNFCLKKNGG--------
-------------------
>TPHA0G02020
------------------------------------------------------------
--------MIPPSGQGAPVAKIDRYSNKKPDYELKKTGYIYMYTYERFY-NSY-VNK-DL
NDIDWLYVDESVINNGK-------TSKLSNWEDN-SKILCKIGMTTTS-VEKRLSEWRNV
CKHDILNLSPERIGNLQSCYVNKTKKIKNDGSK------KSIKKLADIFSALSIKNNKNS
SKEDVISNKT---NQMIPLTNFPFKSYRN-----GGFYSNG-QGNSTVYEIESTIHKYLW
KRHGKAKVYCYGCDPNG---KKYHTEWFNIPIDDLSHVMKVIDTLCYNNSL---------
-------------------
>Kpol_1032.66
------------------------------------------------------------
-----------------------------------------MYTYKEMYEVMLESENHND
SKLQWLFIDESKISKGK---------ELENWSNN-RNILCKIGMTTNK-VPIRLNAWERS
CKHEVINLTPENIQTLLAKQTKLMLQAKPKPTVKNSTWPISMKQMISLFTKMKLKDSKPQ
QQMRI--------QSPSPPIPPNLITYKD-----GGFFHDSKKGTKTLREVEANIHNILW
AKYGKALTNCFGCDPNG---NKHHTEWFCVPISELPNVLKTIDSICHRS-----------
-------------------
>NCAS0B05780
------------------------------------------------------------
-------------------------------------------MYEAYLEGDL------R
KLQTWLYQDNSIIIKEG-------ARKKEIWKAP-DTILIKIGMTRKTDVKVRFKEWMVS
CHHEIIGLTPENMEMLL----KEHHIGFKKKDN--------VNTITHLFKKLSLKKASRA
HG-----------KQKVSIRIQDLYTYKN-----GGFFTDG-NGKLSLEEIENLIHRILW
KKYGKGIIYCSGCNHT-------HTEWFKIPIKDLPFVIQTIDSLCLAQKA---------
-------------------
>NDAI0B03090
------------------------------------------------------------
------------------------------------------------------------
-----------MKKTHR---------EQKSWNSP-DTILVKIGMTTKKNVALRLQEWEKT
CQHPVINLSPERVRNLL--SGREEFMNNDKSDV---------KTLTKWMKKLSLHKKDSK
KVKISA-------EGPIKRQPEILQTYKY-----GGFFHDG-TGHTSLQEIENSIHRLLW
KQYGKGLVYCYGCDPTG---QRRHTEWFNIPIQKLPYVLHTIDSFCLSQNEMVNR-----
-------------------
>CAGL0L06996g
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------MTTKPMVSTRLLEWQNT
CKNPVINLTPDRIEQLI-----YAYDTKTKKIN----------SISTLLTKLELKKEK--
-------------PQSRQESPLDLLTYKD-----GGFFIDG-TSNLNLSEVENRIHRFLW
EKYGKGFIYCYGCDPMG---QKRHTEWFHLPIRDLSSVMRTIDAFCYSG-----------
-------------------
>YPL034W
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------MTTRKTVDSRLLEWQTT
CKHPVINLTPEKVDKLY----HLKLKSESKNISSNRLLPISLSSLQKKMEKLFIKDKSHS
HK-----------PSLPDPKVPTLRTYKD-----GGFFISG-KGSMKLPDIESAIHKFLW
KKYGKGLVYCYGCDPTG---KKRHTEWFNVPVLELPSVLRLIDSYCLGGESR--------
-------------------
>Smik_16.200
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------MTRRKTVDSRLSEWQNT
CKHPIINLTPEKVDKLY----QLKMKCKNKNIRSNKHLPITLSSLQKKMEKLFIKDKGNS
RI-----------SSFSEHKVSSLCTYKN-----GGYFIDG-KCSMKLPDIESAIHRFMW
KKYGKGLIYCYGCDPTG---KKRHTEWFKVPVLELPSVLRIIDSYCRGEESC--------
-------------------
>Suva_16.281
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------MTRRKTVDSRLLEWQNT
CKHPIINLTPEKVDKLY----QLKMKSKTKNERPKKGLHISLSNLQKKMEKLFIDDKYDS
PK-----------PNYAKVESSSFHTYKD-----GGYFIDG-KGLMKLSDIESAIHRFLW
KKYGKGLVYCYGCDPTG---KKRHTEWFNVPVLELPSVLMIIDSFCRRGEC---------
-------------------
>Skud_16.247
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------MTRRETVDLRLLEWQNT
CKHPIINLTPEKVNKLY----QLKLKSTNKNTRSNKVLSISLSNLQKKMEKLFIKDKNHL
PK-----------PPFLEHKVSKLYTYKD-----GGYFIDG-KGSIRLPDIENAIHRFLW
KKYGKGLVYCYGCDPSG---KKRHTEWFNVPVLELPSVLGIIDSFCHEGESP--------
-------------------
>ZYRO0A08140g
------------------------------------------------------------
-----------------------------------------------MY-HSL-VTR-SV
ADIDWLYLDESILSARG---------KRRHWSSN-DQILCKIGMTTRSSVNTRLLEWQNT
CKHPVINLTPERIHLLY---------ESGRNSR----------TLTKILSKLSLN-----
-------------GSKVRPSNPKLQTYNN-----GGFYTNG-KGPKTLAMIENTIHRQLW
QRYGQGLIWCYGCDPEG---HTRHKEWFRVPIKDLPLLARYIDRVCGG------------
-------------------
>TDEL0G03080
------------------------------------------------------------
------------------------------------------------------------
-------------------------------------------MTTKSKVSTRLLEWENS
CKHPVLNLTPDRVATLC-----------SRNSA---------TGLSRLLSKLFLT-----
-------------PSKPTITTKNLQTYHN-----GGFWVPT----GELPAIEHAIHRHLW
QRYGQGLIYCHGCDPSG---KKRHREWFRVPVCDLPWLLTTLDRFCQGLIR---------
-------------------