MUSCLE (3.8) multiple sequence alignment

KLTH0F15906g       --------------------MAPILCFARKFLVAICVTGIILEAIYTGRI---------Q
Kwal_55.21402      --------------------MLPGLVIARKFLVLFCVVIIILEGVYTNKI---------V
TPHA0E01720        --------------------MVNPNIYIFSSCIFIAAVTFGFEMVLYNIYKKYTDQLQRF
KLLA0E02333g       -----------------MFEGFKITKLHLKFWIIIIVLAFIVEMCIVPWL---------F
ACL166W            --------------------MRRFPTPVYTIWILILVAAIVLEMTFLPKL---------I
Ecym_4512          --------------------MRRFSITSYSIWILVLLVAIILEMTFIPKL-----MIEKF
KAFR0E03810        -------------------MMSFKQLIKYFVILSTILIALDLFMCQMFPM---------F
Smik_4.637         -------------MVSLSLYHGSKTSLISHLLILLIIVTIVIEMCLYKKI---------F
YDR371W            -------------MVGHSAQHRSKSSLVSHLLILLIFITIIIEMCLYNKI---------F
Suva_2.543         -------------MVEHSQHHRSNTSIISHLLILLIAITIIIEMCLYNKL---------F
Skud_4.640         -------------MLGYSEQQRSKTSIISHLLILLIIITIIIEMCLYNKI---------F
SAKL0G02684g       MSVHFASIITVSFTLKEVTMQWKRSLTFQTFLICLLTSLLFLEMSVFFGT---------L
CAGL0A02904g       --------------------MHIGHRKRLGTFIVILITSLILQMSLHYKI---------F
KNAG0C04870        --------------------MKRRQKITIAA-VSLVSVTVILTMCFTQLL----------
TBLA0A02790        ------------------MRNDNKAYWRATIILTFIAITLITEMCFYDKL---------F
Kpol_1062.25       -------------------MIRVNQKWWVALALLFVIISIMVESFLYQKF---------L
TDEL0D02600        --------------------MQRRPWLSHTVIIIVILASIAVEMCFYKKI---------F
ZYRO0F10186g       ------------------MHWHNQPWFNHSIILAFIIASIVIEMCFYRKI---------F
NDAI0B05710        -------------------MTYRRTILRIRFLILLAIICFILQMCLTKLF---------F
NCAS0F03420        ----------------MIATRRRKFFLNTGVLFALAIVVLVLQMCLHKLY---------F
                                                   .      .                    

KLTH0F15906g       TSTKMRAFQEHFNNLGRSGAMLSTSNDAGTGLSADNES--------------------G-
Kwal_55.21402      KSIRIKAFQGLYNAIARSEKMQSTVKDKDNSLLISSER--------------------G-
TPHA0E01720        DAKPGNISSELNQHDREYDPIMKPENSEQNNGTENS----------------------L-
KLLA0E02333g       LDKIKKGGSAGRRPPTEIDPDTRVPS--EGPD--------------------------G-
ACL166W            KEKLSRRIRP--KPLEVHEETRPVP---DAPYPDG-----------------------E-
Ecym_4512          KKPRSDIERTALSTITRPVDRNLQH---------------------------------GK
KAFR0E03810        RRRGEEDRRGVTLDDERMHESRNRS-----------------------------------
Smik_4.637         KNQRSNKIRDSFNNGGHKVPNMDQT---QGPNVDGE----------------------G-
YDR371W            KNQRSDDIRDNFNNGGHRVPSNVQN---HGTHIRDE----------------------A-
Suva_2.543         KNQRSEDIRDNFQNGRHQVPNMVQN---QKPSGDDD----------------------G-
Skud_4.640         KSQRSDDIRDNFRNGGDQVPSMVQN---QKPHDGGK----------------------G-
SAKL0G02684g       KGRATQKFKQIYSDMNSNDNNQNLQEEVGPASNDSQ----------------------S-
CAGL0A02904g       QKLKRRSQSDDYRMPESDVLSNTS------------------------------------
KNAG0C04870        -----HKKTEHHHQPPAQCPQNVNQ---------------------------------K-
TBLA0A02790        NKKKEQQVLNQLQPPTKIEPLNNVD---NEIKDNKNTN-------------LTVANPQG-
Kpol_1062.25       KHGSKEESIEDSINESQIVYGKSFP---NNPDS-------------------------G-
TDEL0D02600        HRSAQRKVVDYVQSQPQQAQLVTNP---GTVEPG------------------------Q-
ZYRO0F10186g       KSSAEHDVLDHVHEVGDGSLQQFKD---HHTVIGDE----------------------G-
NDAI0B05710        NSNKEKIVTDHYKNNNNNNNNNNNNNNNDDGNKKGQHHSHLFPQENDIVNYPKLGKTNNT
NCAS0F03420        KQKATQDLIQSHFRNGTIPNRQEIDYLMNQTNSNGEK---------------------G-
                                                                               

KLTH0F15906g       FVTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDEWSDVQMDLYK
Kwal_55.21402      LTSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDEWSDVQMDLYK
TPHA0E01720        YSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDFQIDMYK
KLLA0E02333g       FSVATYYSNWSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFELPLSV
ACL166W            YTVGVYYSSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKMPMNL
Ecym_4512          YAVGVYYTSWSPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSHA
KAFR0E03810        FSCGLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQRPILK
Smik_4.637         FVSGVYYSNWSPYKPRFHFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYK
YDR371W            FISGVYYSNWSPYKPRFHFPHDINLKQVSHIYYAFFKINSRTGGIENTDSWSDLEMNLYK
Suva_2.543         YVSGVYYSNWSPYKPRFHFPHDINLEQVSHVYYAFFRIDPKTGCIGSTDSWSDLEMDLYK
Skud_4.640         YVSGVYYSNWSPYTPRFHFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYK
SAKL0G02684g       YISGVYYTNWSPYAPRNHFPHDMNFHRITNVFYSFFVVDPKSGTVKSSDEWSDFQMDLYK
CAGL0A02904g       YIAGLYYSNWSPYEPRLHFPHDIDFEKVSHIYYAFLLIDPETGNLTSSDEWSDTQLNLAK
KNAG0C04870        YVSGVYYSDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIEMPM--
TBLA0A02790        YTSGVYYSNWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEMDLYK
Kpol_1062.25       YDVGVYYSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMDCYK
TDEL0D02600        YLSGLYYSNWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGMDLYK
ZYRO0F10186g       YTSGLYYSDWSPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMDLYK
NDAI0B05710        FVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEWSDLKMDLYK
NCAS0F03420        YLSGLYYSSWSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYK
                      . **:.**.* .* . * ::   .:: : *:*: ::   .     * *:*       

KLTH0F15906g       QMISSFKKLD------------LRAQFPTGSKDKL--PLGCIGELFFLKYSNFLTRNGGS
Kwal_55.21402      QMFSAFEKVD------------LKRQFPQSSRNDL--PLGCIGELFYLKYTDFLSKMGGP
TPHA0E01720        PLYLSLGQVDN-----------DFDSVPISMKKEL-LPMGCIGEFFYLRNTRIPIHGPKS
KLLA0E02333g       G------------------------------------VKGCIKELQKIKLESK-------
ACL166W            T----------------------------GMPRGL---NGAIGELNYLKTRPG-------
Ecym_4512          P----------------------------GIPQGV---TGMIGELNYLKLQRN-------
KAFR0E03810        -------------------------------NNKL--VKGNVGELFDLKMK---------
Smik_4.637         PLAIKSSELI------------DGNSSN-DIQKIL--PLGCIGELFYLKHSCSG------
YDR371W            SLAIKNSELI------------KESSNN-SVQNIL--PLGCIGELFYLKNTCSD------
Suva_2.543         PLAIKASQLV------------DDNLDDNNMQSIL--PLGCIGELFYLKNACSG------
Skud_4.640         PLAIKSSQLV------------ENNLND-SVQNIL--PLGCVGELFYLKNACSE------
SAKL0G02684g       KFYPQFKAALLSSS--------SSSTFQSHKKEML--PMGCIGELFYLKYSSILPSLHGD
CAGL0A02904g       QCREYMFK--------------RFTGDELKAVTNIRAPPGCIGELNYLRYIYSKIKK---
KNAG0C04870        -----------------------------GKNTVL---KGCIGALNSLRDEK--------
TBLA0A02790        PLSIKLGKLKNKVDVY------EEPQTQSTIKTNL--PKGCIGEFFYLRNSKLLPTINTE
Kpol_1062.25       PLAMKLKKLQ------------LDHFFNPKFKNGL--PMGCIGELFYLRHSQLFDSNNS-
TDEL0D02600        PMAIKLNKLNP-----------EVKNDLERQRRIL--PNGCLGELFYMRNANLFPNRNI-
ZYRO0F10186g       PLAVKLNQLQ------------LKNDDVHASMGVL--PKGCVGELFYLRHTGILDRDKG-
NDAI0B05710        PLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQL--PLGCVGELFYLKKF---------
NCAS0F03420        PLSVKLHNLNL-----------ADNEKPVQLRDKRKLPLGCIGELFYLKHSGIIP--GG-
                                                          * :  :  :.           

KLTH0F15906g       AGVNNFKTIMSVGGWSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKND
Kwal_55.21402      EDVKNFKTIMSVGGWSNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKND
TPHA0E01720        ---TDFKVFMSVGGWSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPEDD
KLLA0E02333g       ---HEFKTILCLGGWSNREAYKKIAKSEKKVKKFIETAVDCMFRYGFDGIDLDWEFPEED
ACL166W            ---TDFKLMMAVGGWSNREPFHKIVRDEEKFNNFIDSAIDAMFEYGFDGIDLDWEFPKDD
Ecym_4512          ---TNFRLFMAVGGWSNREAFPKIVRSEEKLKNFVNSTIDAMFEYGFDGIDLDWEFPKDD
KAFR0E03810        ---NRVKCIMCIGGWSNREAWHIFSTDPSKIESFTEQAVKMMFEYGFDGIDLDWEYPEDD
Smik_4.637         ---KKFKVIMSIGGWSDSENFKVIIKNENLLQAFVDSSVETMFKLGFDGIDLDWEFPENN
YDR371W            ---KKFKVIMSIGGWSDSENFKIIIKDDKLLQNFVDSSVETMFRLGFDGIDLDWEFPGNN
Suva_2.543         ---RKFKSIMSIGGWSDSENFKTIVKNEKLLQNFVDSSVETMFKLGFDGIDIDWEFPENN
Skud_4.640         ---KKFKVIMSIGGWSDSENFKTIVGDDKLLQNFVDSSVETMFKLGFDGIDIDWEFPENN
SAKL0G02684g       GVHRNFKVSMSVGGWSNRDAFPIIVRDKNKFDTFIRTCVETMFQYGFDGLDIDWEFPQND
CAGL0A02904g       ---RNVKLIMSVGGWSNRESFPIMVRDELKFKNFINSCIETMVYYGFDGIDLDWEFPEDD
KNAG0C04870        ---PGFKNIMAVGGWSNKDAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDWEYPKDD
TBLA0A02790        NS-KNFKMIMTIGGWSNRDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNN
Kpol_1062.25       ---RKFKLIMSVGGWSNREAFPRMIRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDD
TDEL0D02600        ---RDFKVIMCVGGWSNREEFPKMVRNPKRVDKFIDSCIETMFKYGFDGIDLDWEFPEDD
ZYRO0F10186g       ---RHFKVMMAVGGWSNRDQWPKMVRDPRRVENFINSCVETMFKYGFDGIDLDWEFPQND
NDAI0B05710        ---QNFKLIMSIGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFPEDD
NCAS0F03420        ---SSTKMILSIGGWSNRDRFPGLVRDTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDD
                         .  : :****: : :     .   .  :    :. *.  ****:::***:* ::

KLTH0F15906g       AKEPKVYLQMLKALRERLDTLESQIFGSKD----------HKHHFALTSAISADEECLKY
Kwal_55.21402      STEPKAYLDMMRSLRKKLDDLESDIFGTEK----------HTQHFLLTSAISADPSCLEY
TPHA0E01720        GFEPMMYLDIIKRLKMKMLELEATIYKDAISHNT------SYPHFELSIAAPAFDEKLRI
KLLA0E02333g       SNEPIVYLEMMRGIREGMDQLERQIFGSPAEEK-------DHPHFQLSVATPAFAEKLNI
ACL166W            GYEPQMYLEMCSRLRHKMDELEDNIWGPGGT---------TEPRFHLSMAAPAFPQTLGI
Ecym_4512          GYEPGMYLEMCSRLRSKMDKLEDEIWGANNT---------DYPKFELSVATPAFSQTLKI
KAFR0E03810        GIEPQLYLEIMRRIKHHMNKLESEIFKDTSA---------TTSYFELSVATPAFKDKLEI
Smik_4.637         KSEPQGYLKLVRMLRSKLNSLESQIFGEG-----------VEDHFQLSIAAPAFKDKLYY
YDR371W            ESEPRGYLKLVRMLRLKLNSLESQIFGKR-----------TEDHFQLSIAAPAFKDKLFY
Suva_2.543         KVEPQGYLKLVRMLRLKLNSLESQIFGGS-----------TKDHFELSIAAPAFKDKLYF
Skud_4.640         KIEPQGYLKLVKMLRLKLNNLESQIFGES-----------IEDHFQISIAAPAFKDKLFF
SAKL0G02684g       GLEPKMYLTMIRRLREALDDLERDIFQDEH----------HSEHFFLTVAVPAFKEKLQV
CAGL0A02904g       SYEPDAYLRMARELKLQLQKLEANILGDH-----------SNKTFQLSMATPAFKDKLSI
KNAG0C04870        GKEPRIYLELMRKIRQHMNELEIAIWGD------------KKRRFHLSVATPAFYDKLET
TBLA0A02790        TQEPAVYLKIMQQLRQGMNELEEEIYKNSAVPVE------ERKHFQLSVASPAFEEKLSV
Kpol_1062.25       KLEPKMYLELVKKLKWKQNELEQKIFNNSGNGNHS-----KRPKFHLSIAAPAFKEKLDI
TDEL0D02600        GFEPQMYLQLAKRLKERMNELEDAIFGPNM----------NHPKFQLSMATPAFSEKLDI
ZYRO0F10186g       GFEPRMYLELARKMRLKFDELEEVIFAGEP----------NHPKFQLSMATPAFKDKLNV
NDAI0B05710        GFEPGKYLEIVQRLRKRMDKLEHDIFQKSKISPHDYDHDYHHPKFELSVATPAFIEKLNI
NCAS0F03420        GLEPNKYLEMISKLRRKMDDLELEIFGETK----------DHPKFQLSVATPAFIYKLSI
                     **  ** :   :.     **  *                   * :: * .*    *  

KLTH0F15906g       LPLQEADRYVDYWNLMAYDFSGAWSAQTAYQSNLY--------------TPAKTNKRS--
Kwal_55.21402      LPLGEIDRYVDQWNLMAYDFSGAWSRHTAYQSNLY-------------SRSSLGKRSE--
TPHA0E01720        LPVQQMDKFVDKWNMMTYDYSGEWSDVTGYHSNLF-------SPPDVSGSVMKRSQSN--
KLLA0E02333g       LPISEMSKYVDIWNMMCYDFHGEWSDVTGYHSNLY------LQGHSHRRSLSNRI-----
ACL166W            FPVEEMNKYLSMWNMMTYDYHGAWSERTGYHSNLY------NATNSPYKSHLDKRRYE-D
Ecym_4512          LPIIEMNKFVSIWNMMTYDFHGSWSKRTGYHSNLY------DGNKN--NDELKKRRFE-G
KAFR0E03810        FPLKEMDTVIDYWNMMTYDYYGEWSERTGYHSNLY------DGSKG--STTIESVLRH--
Smik_4.637         LPIPEIDQYIDYWNMMTYDYYGSWSETTGYHSNLF-------------------------
YDR371W            LPITEIDQYVDYWNMMTYDYYGSWSETTGYHSNLF-------------------------
Suva_2.543         LPIAEIDQYIDHWNMMTYDYYGSWSETTGYHSNLF-------------------------
Skud_4.640         LPISEIDQYIDYWNMMTYDYYGSWSETTGYHSNLF-------------------------
SAKL0G02684g       LPLRDMDAYVDFWNLMAYDYHGEWSELTGYHSNLY---------SEDSNHVHRRHFRD--
CAGL0A02904g       LPIHKLDKYIDLWNLMTYDYYGEWSERTGLHANLY--------NEK--GKLLHLHRHD--
KNAG0C04870        FPIKEMDQYIDYWNMMTYDYYGEWSSGTGFHSNLY------DGTNKF-------------
TBLA0A02790        LPIKEMNKVLDYWNMMTYDYNGEWSEKTGYHSNLY------DGSKVKH------------
Kpol_1062.25       LLMREMDHYVDVWNMMTYDYHGEWSEKTGYHSNLYSPQETRNEDDD--DDDRDEDNEDDD
TDEL0D02600        LPITEMDKYIDIWNMMTYDYHGEWSEKTGYHCNLY------NGSTKSFDETHQKHIYS--
ZYRO0F10186g       LPIKELDRYIDVWNMMTYDYHGEWSPVTGYHCNLY------D-GPV--KVHS-QYKHD--
NDAI0B05710        LPIKEMNKYIDYWNMMTYDYYGDWSEETGYHCNLY------EGGNN--GTINAQYKHE--
NCAS0F03420        LPIIQMDQYVDYWNMMTYDYYGSWSEATGYHCNLF------N-GDG--SEFRAGYKHE--
                   : : . .  :. **:* **: * **  *. :.**:                         

KLTH0F15906g       ----TNGRGSADKAVRFLTDKSKLASKKIVLGMPAYGRGFKGVEVSH-------------
Kwal_55.21402      ----NSEGGSADTAVRLLLNKHKLPAKKIVLGMPAYGRGFKGVSVPH-------------
TPHA0E01720        ----SNETLCGDNAVKYMKDNLKISSRKIILGMAAYGRGFSGVSKS--------------
KLLA0E02333g       ----SNSSLSSDTAVKLMTDRHNISSRRIALGMAAYGRGFTNVETN--------------
ACL166W            MGIDNFDELNAHDAILMMTEQFKVSPRKIALGMAAYGRGFTNVRGD--------------
Ecym_4512          MVIDDNEGLNADDAIKIMVENFKVHAKKVRLGMPAYGRGFTNVQTK--------------
KAFR0E03810        -GMSEVEGLNGDYAVKYMINQ-GIKKDKIILGMAAYGRGFTNVDVPTPRP----------
Smik_4.637         ----SETELSGNFAIHYMIDKFGINSRKLVLGMAAYGRSF-HIKGSGFQPF---------
YDR371W            ----SETELNGNFAMHYMIDRFGVNSRKLVLGMAAYGRSF-HIKDNKFEPF---------
Suva_2.543         ----SETELSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSF-HIKDDKFRPF---------
Skud_4.640         ----SETELSGNFAMHYMIDEFSVDSSKLVLGMAAYGRSF-HIKDSKFQPF---------
SAKL0G02684g       ----EENQLNADSAVKYLLKNFGINSRKVVLGMAAYGRGFTRVKTT--------------
CAGL0A02904g       ----EDAGLSGDAAINYMVNRCKIDPRKVILGMAAYGRGFTNVDMKS-------------
KNAG0C04870        ----SEHSLCADGAIRYMTNKIGINSRKVVLGMALYGRGFTNVKEGDP------------
TBLA0A02790        ----DEEVLNADSAIKYMIETQGVEPNKLVLGLAGYGRGYTNVNVNHIQGFGKNNKEREL
Kpol_1062.25       DDEDDESNLNGDYAINYVIKKYHINPKKINLGMAAYGRGFTKVNAS--------------
TDEL0D02600        --TESVEGLDAHSAIEHMLNVAGVNSHKICLGMAAYGRGFTNVVAQ--------------
ZYRO0F10186g       -SSSDDEGLDANSAISDMINRFGVDSRKITLGMAAYGRGFTHVKAS--------------
NDAI0B05710        -HTSSNKGLNANDAINYMLYNNNVSSRKLVLGLAAYGRGFTKVKVN--------------
NCAS0F03420        -HTAHNNGLNANEAIDFMIKSCNVPSSKVVLGMAAYGREFKHVKSR--------------
                             .  *:  :     :   .: **:. *** :  :                 

KLTH0F15906g       KSIENVIGKPFQDVS------GSSEGEEGISLYKQLPLKGGMEFFDHNAVSAYCVKLSHN
Kwal_55.21402      HSEHNVIGQSFQQVS------GLSEGESGISLYNQLPLKGGQEWFDQDAVSAYSVKLASN
TPHA0E01720        KTNGKLTGKKFNGVS------GSSPDEPGVWLYNKLPIKGSKEEFDKESVSAYC----YD
KLLA0E02333g       --DDNYLGKKYHGVG------GGSEGEPGIWLYNQLPIDGSKEQFDSNAVSAYC----FD
ACL166W            --GEQLIGQKYSGVG------GGSEGEPGMWLYNQLPLAHGPEKFDNVWVSAYS----YD
Ecym_4512          -DDDDLLNKKYSGVG------GGSEGEPGIWLYNQLPLANTAEKFDDRWVSAYC----FD
KAFR0E03810        NESPRYIGRTFDGVG------GASEGEPGMWRYDQLPIPGTVEQFDPRYVSGYC----FE
Smik_4.637         TQNTILINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDPKYVSAYC----FD
YDR371W            NQNTVLINKIFKGVGKPTKEIDKADGKEGIWPYKNLPKIGTIEQYDPKYVSAYC----FD
Suva_2.543         TKNTVLINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYC----FD
Skud_4.640         TQNTVLINQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGTIEQYDPKYVSAYC----FD
SAKL0G02684g       ANSGSYIGKPYNGVG------GASEGEPGMWLYNQLPLPGTLENFDPRSVSAYS----FD
CAGL0A02904g       TNPHNPYGLKFSGVG------GASEGEPGMWLYNQLPIPGSNEKYDYRHVGAYC----YD
KNAG0C04870        KKTSGLINRKFKGVG------GESEGEPGMWLYNQLPIRGTQEVFDEQYGSAYC----FD
TBLA0A02790        TGDEVFIDLEYKGVG------GESEGEPGMWMYNQLPIKGSIEQFDPKFVSAYC----YD
Kpol_1062.25       SQDTRFINKPYRGVG------GASEGEPGMWLYNQLPIKNSLEEFDPDYVSAFC----YD
TDEL0D02600        STDKRFIDKPFHGVG------GASDGEPGMWLYNQLPIQGTHELFDPDYVSGFC----YS
ZYRO0F10186g       SNDKRFIDKSFHGVG------GASEGEPGMWLYNQLPIKGSKEEYDPEYVSGFC----FD
NDAI0B05710        KNDELFINKKFDGVG------GASAGEPGMWLYNQLPIKNSKEMFDPNYVSAFC----YD
NCAS0F03420        QGVDTLINQKFKGVGK-----GGLGDEPGMWLYNQLPLKGTVEMYDPNYGAAFC----YD
                          .  :  *.      .   .: *:  *..**     * :*    ..:.     .

KLTH0F15906g       KKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDYKG--KSLVGAFTK--EIKCL
Kwal_55.21402      KEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRSLTRAFTQ--EIKYL
TPHA0E01720        PKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEKLNNPKLSLINSFTF--DMNNI
KLLA0E02333g       PKSRTFVGYDNVQSMDIKGKYIKKKNLNGGFWWESCGDS-KDPRKSLVNAFSK--EIGLS
ACL166W            PNTKTLVVYDNVDSMKIKKEYVKDKKLAGAFLWESCGDNFKDKDRNLVEAFTE--NMKGA
Ecym_4512          KNLKTFVGYDNIQSMEVKSDYVKQKHLSGGFFWESCGDTHNDPKRNLVRAFSQ--ELSEM
KAFR0E03810        PTTGTFVGYDTIDSVRVKTQYIKMKDIGGGFWWESCGDTHKNPERSLVNAYVK--ELGRD
Smik_4.637         EKNSIFISYDNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNE--GLRSN
YDR371W            EKNSIFISYDNTKSVKTKAEYVTHNNLGGGFWWESCGEAYANESRSLINAFNE--GLHFN
Suva_2.543         EKNSIFIGYDNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFNE--ALHFN
Skud_4.640         EKNSIFISYDNTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLINAFNE--GIRFN
SAKL0G02684g       PKSKTFVGYDNVDSMRCKAQYVKNHNLAGGFWWESCGDNHKDEQKSLLNAFTN--DLGSL
CAGL0A02904g       DRTHTLVGYDNPTSVIEKANYIMSNSLGGAFWWESCGDTHKNPKRSLLNTYIR--VIRNV
KNAG0C04870        PKTKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFNE--DIERL
TBLA0A02790        LKTNTLVTYDNVESMNVKGQYVKDKGLAGGFMWESCGDVHDNPKRSLITAFTN--ELGKI
Kpol_1062.25       KKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNPEKSLLNAFTD--EIGSV
TDEL0D02600        STSKTFVGYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNAFTN--EIKFV
ZYRO0F10186g       HKTKTFVGYDNVESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTG--RIKTI
NDAI0B05710        PKTKTFVGYDNVDTMKVKAKYVQDRHLAGGFWWESCGDDHKHPERSLLNAFTNQLEVKHL
NCAS0F03420        KKSETFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNFSN--EVTEI
                        :: **.  :   *  *:    : *.* **:**:       .*   :     :   

KLTH0F15906g       NKTEP--TIYSLPEVVQHYLKLH-PGGFLASTFQN-------------------------
Kwal_55.21402      NKTVP--TIYALPQVGEYYHKKY-PDGFLASII---------------------------
TPHA0E01720        DKQK---SMFSNRKVLEYYLMKYGKQGFLSGYILSVLNRMNET-----------------
KLLA0E02333g       EGFV---SLFKSDKVKQFHLQKY-PKDYISSLFQKL------------------------
ACL166W            RKA----TAYKDSKLIQYYLRTR-PEGFLVPMYRHTSG----------------------
Ecym_4512          RIP----TIFKDPRAIAYYLKHR-QKGFLYSLFSQHLQKINETSVDKSAGNYKNETLLPK
KAFR0E03810        NIKKP-ESIYKNLHCVSHYKQSFHGKGFLSKYLKEYEKNEFQ------------------
Smik_4.637         VSTKP--SMFENERVVNFYLNKYGNNGFLTPYLKHMDSFKQ-------------------
YDR371W            VSSKP--SIFQDVRVKKYYLNKYGDGGFLSPYLKHLDSRKQ-------------------
Suva_2.543         VSSKP--SMFQDKRVMKYYLSKYGDGGFLAPYLKHLESLK--------------------
Skud_4.640         VSSKP--SMFQDMRVIKFYLNKYGDDGFLSPYLKHLESSKQ-------------------
SAKL0G02684g       AKQQP--SIYTSAHVIRYYLKNY-PQGFLSRVFKG-------------------------
CAGL0A02904g       KNNKE--TIYSTTKLHDYYLENYDTNGFLTGFIKDIIQES--------------------
KNAG0C04870        DRNET--NLYQDPKLREHYLQIFAKSGFLAATFK--------------------------
TBLA0A02790        KKQES--SIFQDEKTFEFYLEEFGNEGYLSEAIAKLLNKDKM------------------
Kpol_1062.25       TEKNE--TMFTNIEVLKYYLKTKGDTGFLSTFIMKLLYRDEIY-----------------
TDEL0D02600        SKFDD--LMYRQTPVLRYYVNKFGNDAFLSPFILNLLAGQGEAPH---------------
ZYRO0F10186g       AKNEN--SVYHKPEALRYYLEKFGQDEFLSPFIIRIISKSH-------------------
NDAI0B05710        MKYEDSHLIYEQPDTIKYYLNYFGNDGFLSPFFIQIMSAM--------------------
NCAS0F03420        RKFSDQDLIFRRKECIAYYLNRYGTDGFLSGILQTS------------------------
                            :       .:        ::                               

KLTH0F15906g       ----------------
Kwal_55.21402      ----------------
TPHA0E01720        ----------------
KLLA0E02333g       ----------------
ACL166W            ----------------
Ecym_4512          DASNELDEGEPTPAAT
KAFR0E03810        ----------------
Smik_4.637         ----------------
YDR371W            ----------------
Suva_2.543         ----------------
Skud_4.640         ----------------
SAKL0G02684g       ----------------
CAGL0A02904g       ----------------
KNAG0C04870        ----------------
TBLA0A02790        ----------------
Kpol_1062.25       ----------------
TDEL0D02600        ----------------
ZYRO0F10186g       ----------------
NDAI0B05710        ----------------
NCAS0F03420        ----------------
                                   

FASTA FORMAT for MUSCLE Version 3.6

>KLTH0F15906g
--------------------MAPILCFARKFLVAICVTGIILEAIYTGRI---------Q
TSTKMRAFQEHFNNLGRSGAMLSTSNDAGTGLSADNES--------------------G-
FVTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDEWSDVQMDLYK
QMISSFKKLD------------LRAQFPTGSKDKL--PLGCIGELFFLKYSNFLTRNGGS
AGVNNFKTIMSVGGWSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKND
AKEPKVYLQMLKALRERLDTLESQIFGSKD----------HKHHFALTSAISADEECLKY
LPLQEADRYVDYWNLMAYDFSGAWSAQTAYQSNLY--------------TPAKTNKRS--
----TNGRGSADKAVRFLTDKSKLASKKIVLGMPAYGRGFKGVEVSH-------------
KSIENVIGKPFQDVS------GSSEGEEGISLYKQLPLKGGMEFFDHNAVSAYCVKLSHN
KKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDYKG--KSLVGAFTK--EIKCL
NKTEP--TIYSLPEVVQHYLKLH-PGGFLASTFQN-------------------------
----------------
>Kwal_55.21402
--------------------MLPGLVIARKFLVLFCVVIIILEGVYTNKI---------V
KSIRIKAFQGLYNAIARSEKMQSTVKDKDNSLLISSER--------------------G-
LTSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDEWSDVQMDLYK
QMFSAFEKVD------------LKRQFPQSSRNDL--PLGCIGELFYLKYTDFLSKMGGP
EDVKNFKTIMSVGGWSNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKND
STEPKAYLDMMRSLRKKLDDLESDIFGTEK----------HTQHFLLTSAISADPSCLEY
LPLGEIDRYVDQWNLMAYDFSGAWSRHTAYQSNLY-------------SRSSLGKRSE--
----NSEGGSADTAVRLLLNKHKLPAKKIVLGMPAYGRGFKGVSVPH-------------
HSEHNVIGQSFQQVS------GLSEGESGISLYNQLPLKGGQEWFDQDAVSAYSVKLASN
KEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRSLTRAFTQ--EIKYL
NKTVP--TIYALPQVGEYYHKKY-PDGFLASII---------------------------
----------------
>TPHA0E01720
--------------------MVNPNIYIFSSCIFIAAVTFGFEMVLYNIYKKYTDQLQRF
DAKPGNISSELNQHDREYDPIMKPENSEQNNGTENS----------------------L-
YSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDFQIDMYK
PLYLSLGQVDN-----------DFDSVPISMKKEL-LPMGCIGEFFYLRNTRIPIHGPKS
---TDFKVFMSVGGWSNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPEDD
GFEPMMYLDIIKRLKMKMLELEATIYKDAISHNT------SYPHFELSIAAPAFDEKLRI
LPVQQMDKFVDKWNMMTYDYSGEWSDVTGYHSNLF-------SPPDVSGSVMKRSQSN--
----SNETLCGDNAVKYMKDNLKISSRKIILGMAAYGRGFSGVSKS--------------
KTNGKLTGKKFNGVS------GSSPDEPGVWLYNKLPIKGSKEEFDKESVSAYC----YD
PKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEKLNNPKLSLINSFTF--DMNNI
DKQK---SMFSNRKVLEYYLMKYGKQGFLSGYILSVLNRMNET-----------------
----------------
>KLLA0E02333g
-----------------MFEGFKITKLHLKFWIIIIVLAFIVEMCIVPWL---------F
LDKIKKGGSAGRRPPTEIDPDTRVPS--EGPD--------------------------G-
FSVATYYSNWSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFELPLSV
G------------------------------------VKGCIKELQKIKLESK-------
---HEFKTILCLGGWSNREAYKKIAKSEKKVKKFIETAVDCMFRYGFDGIDLDWEFPEED
SNEPIVYLEMMRGIREGMDQLERQIFGSPAEEK-------DHPHFQLSVATPAFAEKLNI
LPISEMSKYVDIWNMMCYDFHGEWSDVTGYHSNLY------LQGHSHRRSLSNRI-----
----SNSSLSSDTAVKLMTDRHNISSRRIALGMAAYGRGFTNVETN--------------
--DDNYLGKKYHGVG------GGSEGEPGIWLYNQLPIDGSKEQFDSNAVSAYC----FD
PKSRTFVGYDNVQSMDIKGKYIKKKNLNGGFWWESCGDS-KDPRKSLVNAFSK--EIGLS
EGFV---SLFKSDKVKQFHLQKY-PKDYISSLFQKL------------------------
----------------
>ACL166W
--------------------MRRFPTPVYTIWILILVAAIVLEMTFLPKL---------I
KEKLSRRIRP--KPLEVHEETRPVP---DAPYPDG-----------------------E-
YTVGVYYSSWSPYKPRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKMPMNL
T----------------------------GMPRGL---NGAIGELNYLKTRPG-------
---TDFKLMMAVGGWSNREPFHKIVRDEEKFNNFIDSAIDAMFEYGFDGIDLDWEFPKDD
GYEPQMYLEMCSRLRHKMDELEDNIWGPGGT---------TEPRFHLSMAAPAFPQTLGI
FPVEEMNKYLSMWNMMTYDYHGAWSERTGYHSNLY------NATNSPYKSHLDKRRYE-D
MGIDNFDELNAHDAILMMTEQFKVSPRKIALGMAAYGRGFTNVRGD--------------
--GEQLIGQKYSGVG------GGSEGEPGMWLYNQLPLAHGPEKFDNVWVSAYS----YD
PNTKTLVVYDNVDSMKIKKEYVKDKKLAGAFLWESCGDNFKDKDRNLVEAFTE--NMKGA
RKA----TAYKDSKLIQYYLRTR-PEGFLVPMYRHTSG----------------------
----------------
>Ecym_4512
--------------------MRRFSITSYSIWILVLLVAIILEMTFIPKL-----MIEKF
KKPRSDIERTALSTITRPVDRNLQH---------------------------------GK
YAVGVYYTSWSPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSHA
P----------------------------GIPQGV---TGMIGELNYLKLQRN-------
---TNFRLFMAVGGWSNREAFPKIVRSEEKLKNFVNSTIDAMFEYGFDGIDLDWEFPKDD
GYEPGMYLEMCSRLRSKMDKLEDEIWGANNT---------DYPKFELSVATPAFSQTLKI
LPIIEMNKFVSIWNMMTYDFHGSWSKRTGYHSNLY------DGNKN--NDELKKRRFE-G
MVIDDNEGLNADDAIKIMVENFKVHAKKVRLGMPAYGRGFTNVQTK--------------
-DDDDLLNKKYSGVG------GGSEGEPGIWLYNQLPLANTAEKFDDRWVSAYC----FD
KNLKTFVGYDNIQSMEVKSDYVKQKHLSGGFFWESCGDTHNDPKRNLVRAFSQ--ELSEM
RIP----TIFKDPRAIAYYLKHR-QKGFLYSLFSQHLQKINETSVDKSAGNYKNETLLPK
DASNELDEGEPTPAAT
>KAFR0E03810
-------------------MMSFKQLIKYFVILSTILIALDLFMCQMFPM---------F
RRRGEEDRRGVTLDDERMHESRNRS-----------------------------------
FSCGLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQRPILK
-------------------------------NNKL--VKGNVGELFDLKMK---------
---NRVKCIMCIGGWSNREAWHIFSTDPSKIESFTEQAVKMMFEYGFDGIDLDWEYPEDD
GIEPQLYLEIMRRIKHHMNKLESEIFKDTSA---------TTSYFELSVATPAFKDKLEI
FPLKEMDTVIDYWNMMTYDYYGEWSERTGYHSNLY------DGSKG--STTIESVLRH--
-GMSEVEGLNGDYAVKYMINQ-GIKKDKIILGMAAYGRGFTNVDVPTPRP----------
NESPRYIGRTFDGVG------GASEGEPGMWRYDQLPIPGTVEQFDPRYVSGYC----FE
PTTGTFVGYDTIDSVRVKTQYIKMKDIGGGFWWESCGDTHKNPERSLVNAYVK--ELGRD
NIKKP-ESIYKNLHCVSHYKQSFHGKGFLSKYLKEYEKNEFQ------------------
----------------
>Smik_4.637
-------------MVSLSLYHGSKTSLISHLLILLIIVTIVIEMCLYKKI---------F
KNQRSNKIRDSFNNGGHKVPNMDQT---QGPNVDGE----------------------G-
FVSGVYYSNWSPYKPRFHFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYK
PLAIKSSELI------------DGNSSN-DIQKIL--PLGCIGELFYLKHSCSG------
---KKFKVIMSIGGWSDSENFKVIIKNENLLQAFVDSSVETMFKLGFDGIDLDWEFPENN
KSEPQGYLKLVRMLRSKLNSLESQIFGEG-----------VEDHFQLSIAAPAFKDKLYY
LPIPEIDQYIDYWNMMTYDYYGSWSETTGYHSNLF-------------------------
----SETELSGNFAIHYMIDKFGINSRKLVLGMAAYGRSF-HIKGSGFQPF---------
TQNTILINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDPKYVSAYC----FD
EKNSIFISYDNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNE--GLRSN
VSTKP--SMFENERVVNFYLNKYGNNGFLTPYLKHMDSFKQ-------------------
----------------
>YDR371W
-------------MVGHSAQHRSKSSLVSHLLILLIFITIIIEMCLYNKI---------F
KNQRSDDIRDNFNNGGHRVPSNVQN---HGTHIRDE----------------------A-
FISGVYYSNWSPYKPRFHFPHDINLKQVSHIYYAFFKINSRTGGIENTDSWSDLEMNLYK
SLAIKNSELI------------KESSNN-SVQNIL--PLGCIGELFYLKNTCSD------
---KKFKVIMSIGGWSDSENFKIIIKDDKLLQNFVDSSVETMFRLGFDGIDLDWEFPGNN
ESEPRGYLKLVRMLRLKLNSLESQIFGKR-----------TEDHFQLSIAAPAFKDKLFY
LPITEIDQYVDYWNMMTYDYYGSWSETTGYHSNLF-------------------------
----SETELNGNFAMHYMIDRFGVNSRKLVLGMAAYGRSF-HIKDNKFEPF---------
NQNTVLINKIFKGVGKPTKEIDKADGKEGIWPYKNLPKIGTIEQYDPKYVSAYC----FD
EKNSIFISYDNTKSVKTKAEYVTHNNLGGGFWWESCGEAYANESRSLINAFNE--GLHFN
VSSKP--SIFQDVRVKKYYLNKYGDGGFLSPYLKHLDSRKQ-------------------
----------------
>Suva_2.543
-------------MVEHSQHHRSNTSIISHLLILLIAITIIIEMCLYNKL---------F
KNQRSEDIRDNFQNGRHQVPNMVQN---QKPSGDDD----------------------G-
YVSGVYYSNWSPYKPRFHFPHDINLEQVSHVYYAFFRIDPKTGCIGSTDSWSDLEMDLYK
PLAIKASQLV------------DDNLDDNNMQSIL--PLGCIGELFYLKNACSG------
---RKFKSIMSIGGWSDSENFKTIVKNEKLLQNFVDSSVETMFKLGFDGIDIDWEFPENN
KVEPQGYLKLVRMLRLKLNSLESQIFGGS-----------TKDHFELSIAAPAFKDKLYF
LPIAEIDQYIDHWNMMTYDYYGSWSETTGYHSNLF-------------------------
----SETELSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSF-HIKDDKFRPF---------
TKNTVLINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYC----FD
EKNSIFIGYDNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFNE--ALHFN
VSSKP--SMFQDKRVMKYYLSKYGDGGFLAPYLKHLESLK--------------------
----------------
>Skud_4.640
-------------MLGYSEQQRSKTSIISHLLILLIIITIIIEMCLYNKI---------F
KSQRSDDIRDNFRNGGDQVPSMVQN---QKPHDGGK----------------------G-
YVSGVYYSNWSPYTPRFHFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYK
PLAIKSSQLV------------ENNLND-SVQNIL--PLGCVGELFYLKNACSE------
---KKFKVIMSIGGWSDSENFKTIVGDDKLLQNFVDSSVETMFKLGFDGIDIDWEFPENN
KIEPQGYLKLVKMLRLKLNNLESQIFGES-----------IEDHFQISIAAPAFKDKLFF
LPISEIDQYIDYWNMMTYDYYGSWSETTGYHSNLF-------------------------
----SETELSGNFAMHYMIDEFSVDSSKLVLGMAAYGRSF-HIKDSKFQPF---------
TQNTVLINQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGTIEQYDPKYVSAYC----FD
EKNSIFISYDNTKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLINAFNE--GIRFN
VSSKP--SMFQDMRVIKFYLNKYGDDGFLSPYLKHLESSKQ-------------------
----------------
>SAKL0G02684g
MSVHFASIITVSFTLKEVTMQWKRSLTFQTFLICLLTSLLFLEMSVFFGT---------L
KGRATQKFKQIYSDMNSNDNNQNLQEEVGPASNDSQ----------------------S-
YISGVYYTNWSPYAPRNHFPHDMNFHRITNVFYSFFVVDPKSGTVKSSDEWSDFQMDLYK
KFYPQFKAALLSSS--------SSSTFQSHKKEML--PMGCIGELFYLKYSSILPSLHGD
GVHRNFKVSMSVGGWSNRDAFPIIVRDKNKFDTFIRTCVETMFQYGFDGLDIDWEFPQND
GLEPKMYLTMIRRLREALDDLERDIFQDEH----------HSEHFFLTVAVPAFKEKLQV
LPLRDMDAYVDFWNLMAYDYHGEWSELTGYHSNLY---------SEDSNHVHRRHFRD--
----EENQLNADSAVKYLLKNFGINSRKVVLGMAAYGRGFTRVKTT--------------
ANSGSYIGKPYNGVG------GASEGEPGMWLYNQLPLPGTLENFDPRSVSAYS----FD
PKSKTFVGYDNVDSMRCKAQYVKNHNLAGGFWWESCGDNHKDEQKSLLNAFTN--DLGSL
AKQQP--SIYTSAHVIRYYLKNY-PQGFLSRVFKG-------------------------
----------------
>CAGL0A02904g
--------------------MHIGHRKRLGTFIVILITSLILQMSLHYKI---------F
QKLKRRSQSDDYRMPESDVLSNTS------------------------------------
YIAGLYYSNWSPYEPRLHFPHDIDFEKVSHIYYAFLLIDPETGNLTSSDEWSDTQLNLAK
QCREYMFK--------------RFTGDELKAVTNIRAPPGCIGELNYLRYIYSKIKK---
---RNVKLIMSVGGWSNRESFPIMVRDELKFKNFINSCIETMVYYGFDGIDLDWEFPEDD
SYEPDAYLRMARELKLQLQKLEANILGDH-----------SNKTFQLSMATPAFKDKLSI
LPIHKLDKYIDLWNLMTYDYYGEWSERTGLHANLY--------NEK--GKLLHLHRHD--
----EDAGLSGDAAINYMVNRCKIDPRKVILGMAAYGRGFTNVDMKS-------------
TNPHNPYGLKFSGVG------GASEGEPGMWLYNQLPIPGSNEKYDYRHVGAYC----YD
DRTHTLVGYDNPTSVIEKANYIMSNSLGGAFWWESCGDTHKNPKRSLLNTYIR--VIRNV
KNNKE--TIYSTTKLHDYYLENYDTNGFLTGFIKDIIQES--------------------
----------------
>KNAG0C04870
--------------------MKRRQKITIAA-VSLVSVTVILTMCFTQLL----------
-----HKKTEHHHQPPAQCPQNVNQ---------------------------------K-
YVSGVYYSDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIEMPM--
-----------------------------GKNTVL---KGCIGALNSLRDEK--------
---PGFKNIMAVGGWSNKDAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDWEYPKDD
GKEPRIYLELMRKIRQHMNELEIAIWGD------------KKRRFHLSVATPAFYDKLET
FPIKEMDQYIDYWNMMTYDYYGEWSSGTGFHSNLY------DGTNKF-------------
----SEHSLCADGAIRYMTNKIGINSRKVVLGMALYGRGFTNVKEGDP------------
KKTSGLINRKFKGVG------GESEGEPGMWLYNQLPIRGTQEVFDEQYGSAYC----FD
PKTKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFNE--DIERL
DRNET--NLYQDPKLREHYLQIFAKSGFLAATFK--------------------------
----------------
>TBLA0A02790
------------------MRNDNKAYWRATIILTFIAITLITEMCFYDKL---------F
NKKKEQQVLNQLQPPTKIEPLNNVD---NEIKDNKNTN-------------LTVANPQG-
YTSGVYYSNWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEMDLYK
PLSIKLGKLKNKVDVY------EEPQTQSTIKTNL--PKGCIGEFFYLRNSKLLPTINTE
NS-KNFKMIMTIGGWSNRDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNN
TQEPAVYLKIMQQLRQGMNELEEEIYKNSAVPVE------ERKHFQLSVASPAFEEKLSV
LPIKEMNKVLDYWNMMTYDYNGEWSEKTGYHSNLY------DGSKVKH------------
----DEEVLNADSAIKYMIETQGVEPNKLVLGLAGYGRGYTNVNVNHIQGFGKNNKEREL
TGDEVFIDLEYKGVG------GESEGEPGMWMYNQLPIKGSIEQFDPKFVSAYC----YD
LKTNTLVTYDNVESMNVKGQYVKDKGLAGGFMWESCGDVHDNPKRSLITAFTN--ELGKI
KKQES--SIFQDEKTFEFYLEEFGNEGYLSEAIAKLLNKDKM------------------
----------------
>Kpol_1062.25
-------------------MIRVNQKWWVALALLFVIISIMVESFLYQKF---------L
KHGSKEESIEDSINESQIVYGKSFP---NNPDS-------------------------G-
YDVGVYYSNWSPYTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMDCYK
PLAMKLKKLQ------------LDHFFNPKFKNGL--PMGCIGELFYLRHSQLFDSNNS-
---RKFKLIMSVGGWSNREAFPRMIRDSKKLDAFVNSCIENMFNYGFDGIELDWEFPKDD
KLEPKMYLELVKKLKWKQNELEQKIFNNSGNGNHS-----KRPKFHLSIAAPAFKEKLDI
LLMREMDHYVDVWNMMTYDYHGEWSEKTGYHSNLYSPQETRNEDDD--DDDRDEDNEDDD
DDEDDESNLNGDYAINYVIKKYHINPKKINLGMAAYGRGFTKVNAS--------------
SQDTRFINKPYRGVG------GASEGEPGMWLYNQLPIKNSLEEFDPDYVSAFC----YD
KKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNPEKSLLNAFTD--EIGSV
TEKNE--TMFTNIEVLKYYLKTKGDTGFLSTFIMKLLYRDEIY-----------------
----------------
>TDEL0D02600
--------------------MQRRPWLSHTVIIIVILASIAVEMCFYKKI---------F
HRSAQRKVVDYVQSQPQQAQLVTNP---GTVEPG------------------------Q-
YLSGLYYSNWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGMDLYK
PMAIKLNKLNP-----------EVKNDLERQRRIL--PNGCLGELFYMRNANLFPNRNI-
---RDFKVIMCVGGWSNREEFPKMVRNPKRVDKFIDSCIETMFKYGFDGIDLDWEFPEDD
GFEPQMYLQLAKRLKERMNELEDAIFGPNM----------NHPKFQLSMATPAFSEKLDI
LPITEMDKYIDIWNMMTYDYHGEWSEKTGYHCNLY------NGSTKSFDETHQKHIYS--
--TESVEGLDAHSAIEHMLNVAGVNSHKICLGMAAYGRGFTNVVAQ--------------
STDKRFIDKPFHGVG------GASDGEPGMWLYNQLPIQGTHELFDPDYVSGFC----YS
STSKTFVGYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNAFTN--EIKFV
SKFDD--LMYRQTPVLRYYVNKFGNDAFLSPFILNLLAGQGEAPH---------------
----------------
>ZYRO0F10186g
------------------MHWHNQPWFNHSIILAFIIASIVIEMCFYRKI---------F
KSSAEHDVLDHVHEVGDGSLQQFKD---HHTVIGDE----------------------G-
YTSGLYYSDWSPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMDLYK
PLAVKLNQLQ------------LKNDDVHASMGVL--PKGCVGELFYLRHTGILDRDKG-
---RHFKVMMAVGGWSNRDQWPKMVRDPRRVENFINSCVETMFKYGFDGIDLDWEFPQND
GFEPRMYLELARKMRLKFDELEEVIFAGEP----------NHPKFQLSMATPAFKDKLNV
LPIKELDRYIDVWNMMTYDYHGEWSPVTGYHCNLY------D-GPV--KVHS-QYKHD--
-SSSDDEGLDANSAISDMINRFGVDSRKITLGMAAYGRGFTHVKAS--------------
SNDKRFIDKSFHGVG------GASEGEPGMWLYNQLPIKGSKEEYDPEYVSGFC----FD
HKTKTFVGYDNVESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTG--RIKTI
AKNEN--SVYHKPEALRYYLEKFGQDEFLSPFIIRIISKSH-------------------
----------------
>NDAI0B05710
-------------------MTYRRTILRIRFLILLAIICFILQMCLTKLF---------F
NSNKEKIVTDHYKNNNNNNNNNNNNNNNDDGNKKGQHHSHLFPQENDIVNYPKLGKTNNT
FVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEWSDLKMDLYK
PLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQL--PLGCVGELFYLKKF---------
---QNFKLIMSIGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFPEDD
GFEPGKYLEIVQRLRKRMDKLEHDIFQKSKISPHDYDHDYHHPKFELSVATPAFIEKLNI
LPIKEMNKYIDYWNMMTYDYYGDWSEETGYHCNLY------EGGNN--GTINAQYKHE--
-HTSSNKGLNANDAINYMLYNNNVSSRKLVLGLAAYGRGFTKVKVN--------------
KNDELFINKKFDGVG------GASAGEPGMWLYNQLPIKNSKEMFDPNYVSAFC----YD
PKTKTFVGYDNVDTMKVKAKYVQDRHLAGGFWWESCGDDHKHPERSLLNAFTNQLEVKHL
MKYEDSHLIYEQPDTIKYYLNYFGNDGFLSPFFIQIMSAM--------------------
----------------
>NCAS0F03420
----------------MIATRRRKFFLNTGVLFALAIVVLVLQMCLHKLY---------F
KQKATQDLIQSHFRNGTIPNRQEIDYLMNQTNSNGEK---------------------G-
YLSGLYYSSWSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYK
PLSVKLHNLNL-----------ADNEKPVQLRDKRKLPLGCIGELFYLKHSGIIP--GG-
---SSTKMILSIGGWSNRDRFPGLVRDTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDD
GLEPNKYLEMISKLRRKMDDLELEIFGETK----------DHPKFQLSVATPAFIYKLSI
LPIIQMDQYVDYWNMMTYDYYGSWSEATGYHCNLF------N-GDG--SEFRAGYKHE--
-HTAHNNGLNANEAIDFMIKSCNVPSSKVVLGMAAYGREFKHVKSR--------------
QGVDTLINQKFKGVGK-----GGLGDEPGMWLYNQLPLKGTVEMYDPNYGAAFC----YD
KKSETFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNFSN--EVTEI
RKFSDQDLIFRRKECIAYYLNRYGTDGFLSGILQTS------------------------
----------------