MUSCLE (3.8) multiple sequence alignment

CAGL0A02860g       -----------------MEEVVNQLEALSLSN-------------DKRRVKGQRKGKKKK
KNAG0C04890        --------MGTMTTAIETDDLLNSFHRLSIND----------------------------
TBLA0A02800        -----------------MTNLEDNFSKMSLDG----------------NDKNSHNIHKLP
TPHA0J02600        MENANEGKNNTSLPEDNACILVEGLEKLSIDG-------------TTNVSRKNKAKKGKD
ZYRO0F10098g       ------------------------------------------------------------
Kpol_1016.4        -------------MDEHINDVQTQLSNLKIGE----------------------DNPSRK
TDEL0B02180        ---MSKTSDSSTASSLEVHLLGNKLNSLGLQD-----------------------SPHGP
Suva_2.542         ----------MSPEQDGVVKLAKDLEGINLRDVPNPVNEHRKKSSKRKIIPISSLKRPSS
Smik_4.636         ----------MPTEHDAVVRLTKELDGINLHSAPDIVREHQKKSFNWKTNSVSSLGNMSL
YDR370C            ----------MSTEQDAVLGLAKDLEGINLLTVPNLERGHQSKLCKEKTTSDSSSSRKPS
Skud_4.639         ----------MSTEDDPIARLTKNLESTNLNIVPDLVKGHQKRSSEGRSISITSSVKPPS
KAFR0E03820        ------------MAAASLNATIENFHGLSLGS----------------------------
NDAI0B05690        --------MTTSTKPYDFTNLSRELNAVKEET----------------------------
NCAS0F03400        -----------------MKKTGQELMPLHTTV----------------------------
KLLA0E02245g       -----MTTVSCDKDENKVDQLGESLSQLRIST----------------------------
AER404C            -------------MADDISTLAGKMRHLTLEK----------------------------
SAKL0G02596g       -------------MTIPTDELTADISKLSLQH----------------------------
KLTH0F15994g       --------------------MQKLFEKLSLED----------------------------
Kwal_55.21415      --------------------MLPNLQDLSLQD----------------------------
                                                                               

CAGL0A02860g       HGNSRARDDHTVVIRGNKQRLKTSHHKNMPQ-----FYDSAKTLGIFH---DHKLYEMNR
KNAG0C04890        ------------QKRVRFKEFHHHDPGKYVSKPAH-IFQKSKEVACYT---GGKLYINDG
TBLA0A02800        VCSHSLPGKKYQGGSIRFNSFVKPSKTHFSD-----LYRTSKEVATYH---LGNLNINTD
TPHA0J02600        KKKSRGKYSDDIIARIPFKHFSYSNAHIGKSQPN--IFQEAKGVALYY---DKRITKITN
ZYRO0F10098g       MSHSKCSRNRAQLPSVPFNQFQHSSAFRFPSEPRN-LFTKYKEASYYY---GGQLHDSIS
Kpol_1016.4        VKQNKSRPKKNVINIIPFHRFVHSNARSFPQKTKD-LFLESKTVAFFQ---KDQLFINVE
TDEL0B02180        SKQRRKQQSGKRTVCIPFSKFEHSDLDYFPDDTAD-FFEGCEEVATYQ---NGYLFMKDS
Suva_2.542         QQKNDYLEEISEFTRVPYSSFLHTSIRNFPTKPPPDIFYESKEVALFT---DNQLYVAAR
Smik_4.636         QQSENHINGHPKFTRVSYTSFSHSGMHKFPAKPPRDIFHESKEVALFT---NGQAYTTVR
YDR370C            QQRDNYRKRRPKLICIPYTSFLHTGMHNFLTKPPRDIFHESKEVALFT---NGRAYTILR
Skud_4.639         PQKDDYWNRCSRFKCVPYTSFVHTSIHDLSRKPPGDIFQDSKEVALFT---NYQAYTTAR
KAFR0E03820        ------GKTQKTPIVSPFKRFQHRSIAYFPNHPAN-FFQISREVATYH---DGRIYEPNE
NDAI0B05690        -NASKEVITAPPITTIPFKQFKHCSISTYPKTPSS-FFETSKDVALYH---NKQLYSSDD
NCAS0F03400        -----QSQKQAPITRVPFGEFSHSSISLFPTCTQP-FYESSNQVALYH---NHKLYPASQ
KLLA0E02245g       -RKNNKPSQKKGSLVLSCKKFPHVSVNYVVDKTPK-LLTDCKEVHNCSYIINDATLLWNE
AER404C            ----------DLIVNVNMKKFPHGPITRRGKERSIRIFSESREVGTAFR--QGLVYDLDD
SAKL0G02596g       ----------GSQNTANCKGFVHSNVSHFPSVPCK-FFQESREIGTFTRMVSSGKYLFDD
KLTH0F15994g       ---------LPDEACVSCRGFERASISHFPAEPLH-FFDEVKEIGTMTHWIDSDKFELGR
Kwal_55.21415      ---------RTEEVHANCKNFQHAQINQFPKNVLP-FFDEVQEVATITHLLDTDEFLLDD
                                       :               :                       

CAGL0A02860g       M--DLF-----PQLKDPIAHI--AKSTPAEKT--QLVRPFLGISLYENHDKYS-PMTAKE
KNAG0C04890        NTTNLT---ILPLLKEDIAAL---AQSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDM
TBLA0A02800        P--TIEHTKGVPCLKDDICQI--AGKSLLDSK--KYKAKYIGADLFKDYEKYH-AMEKEP
TPHA0J02600        NEAELINESNPPFLTKDISNL--SEISLLDSK--KFKLPYMGYNLYDEIEKFG-PMDSTL
ZYRO0F10098g       D--SIG-------LKS-------PGNKLSHDRSCSNKRDFLGSDLYQGWEDFL-PLSPEI
Kpol_1016.4        D--AAL-----PLLKKDIANI--SGKSVLNSK--KYKLPYLGSDLYASTDKYG-PLPEDV
TDEL0B02180        SKKPLY-----PCLQM-------FAALIAENRGPKNKLPYIGCDLYQGHERYK-PLPSSE
Suva_2.542         K--DVI-----PNLKEDISHL--YESPLLEAR--KLKTLYLGLDLFANIDELV-PMTISE
Smik_4.636         K--DIL-----PNLKGDIAEL--CERSLLDAR--ERKLPYLGHDLFANIGQFV-PMTISE
YDR370C            K--DLI-----PNLKESIAEL--YESSLLEAK--KRKVPYLGHDLFANIDEFV-PMTISE
Skud_4.639         K--DLI-----PSLRDGITEL--YESSLLEAR--RRKVPYLGHDLFANIDQFV-PMTISE
KAFR0E03820        TSQDIL-----PLLNKDISKIA-QGVSAIDAR--KYKVKYIGSDLYQGFENFE-SMSREE
NDAI0B05690        T--NLI-----PQLEPAIAKLANPSCSLNEAR--DLKLPYLGSDLYDGYESFI-PMDPDE
NCAS0F03400        Y--DII-----PHLKNDIAQL--PKKSASEAR--TLKRSYLGSDLYDGFETFV-PMSAKD
KLLA0E02245g       A--SRK-----PRLRPEVCTY--IKDSKWENK--AVKDSFIGIDLTKGYDDYV-PLDRNV
AER404C            K--KNL-----PLLNDEICEY-------ISHRSKSKLIGYVGSDLSVESETFH-PVTSEE
SAKL0G02596g       K--LGL-----RPLKDDICEY--IHNPAKNAS--KIKTQYLGYDLLNGFEDYI-PLSEDE
KLTH0F15994g       K--QSA-----PHLKKDLGLFTITKKLAKTNS-------YVGHDLLEHYDDFQ-PLTPNQ
Kwal_55.21415      K--LGM-----PELVQDLCEF--TESGKLANK-----GKYIGHDLLDHFDEYV-PITPKQ
                                *                         ::* .*         .:    

CAGL0A02860g       LDTTEACSTYLDQYENSHG---QKYGEDRDFVIVTARHHMIDLAILPF---------SRQ
KNAG0C04890        LDSAKPCLDYINEWNRGSKGE-KKFGESYRHIIVGPRHHLVELTMALF----------AN
TBLA0A02800        LHDPISCFKYIQYYDKKHANEKKKYGMDKEFVIITSRHHINDLVLAPF--------KKIS
TPHA0J02600        LDSTVPCFEYLRTLKISEED--KLYNT--PYTFMTPRHHLTELMMTVY---------ESR
ZYRO0F10098g       LDSSRGCYQWINKWENDNH---TSYSQRSPFVVISPRHYLVELTMQLF-----------Q
Kpol_1016.4        LDSPKPCFDFIRHWENEHRG--EHYGAHADYTILSPRHHITEIVMSLF--------EDEK
TDEL0B02180        LDSSIACFEYIKKWERRKIS--KSFNSG-KVTIISPRHHVVDLVMALF-----------H
Suva_2.542         LDTIAPCISYIEDWRLNNSG--KPFKIGKKFTVVTTRHHIVDLTMHPF---------DRR
Smik_4.636         LDSILPCISYIENWRLNNHG--EDFKIGRKFTVVTTRHHIVDMTMHLF---------DRR
YDR370C            LDSVSPCFSYIENWILDNPG--KDFKIGKKFTVVTTRHHIVDLTMHLF---------NRR
Skud_4.639         LDSISPCISYVENWKLSNHG--KNFKIGKKFTIVSARHHIVDLTMHRF---------DRR
KAFR0E03820        LDSALPCFAYIKKWEAHHH---CKYTENKKYTIVSARHHIVNLIMSIF----------DT
NDAI0B05690        LDSIEPCFKYIESWELQNK---HDYQLGNKFTIVSARHHIVEMTMCIF--------NKRK
NCAS0F03400        LDSLEPCMSFIKDWERKAS---TKYKPGRKFNIVSTRHHIVEMTMKLFTGKTNNYNNTKK
KLLA0E02245g       LNSLVILKEAYQRYE-------KTLNPE-KTTFVSLRHHIIDIIMCPF-----------L
AER404C            LHCLHGLLKFIAKWEADNE---VNYASRSKFTIVSPRHHILDILMIPF-----------G
SAKL0G02596g       LNNMDGILNFIGNWEEKNG---KKYGSENKFTIVSNRHHLIDLIMCPF-----------S
KLTH0F15994g       LEDMSGVFEFLNKWEGDHG---KPYSSGSDFTIVCSRHNLIDLIMAPF-----------S
Kwal_55.21415      LEDMAGVQAFLERWKQLHG---RSFCDNADFTIVCSRHNLIDLIMMPF-----------S
                   *                               .:  ** : :: :  :            

CAGL0A02860g       FTNVNLL-CAYTP--GNLLEISQ--DPADNTNDKVGVN-TDNPILKKICFSGFALEDILT
KNAG0C04890        DSDYKLV-CTVLR--GKFIVLSQ-FDDGSQRNRNEGIT-LSDRRTRMLCYSGFVICKIWS
TBLA0A02800        DPEVSVL-LTYLG--DNRILLSQ-DYAHEPPDWRENKQ-FYNSM-RKIVNSGFAFEDLVI
TPHA0J02600        ESELTGKSWLFTRIKDDLIVISE-DLAKENNPSPQNHK-LQNSFSKKVINSGFTFEELVI
ZYRO0F10098g       QSKYSIL-CTHLG--DGKIVLSQ---VENDKKSHQHTS-RNTTMTKKILHSGYALEDLLT
Kpol_1016.4        NCSVYLL-CTYLK--NGIILLSKDDASSSSNSNTTGLN-SSNPMTRKICYSGFAFEDLVL
TDEL0B02180        DDEVSII-CTNIG--KGKLIFSG----DRSKEERNGLN-SKNSMTRKICYSGFALEDKLT
Suva_2.542         NKQKSII-ATYMG--NGFISLSR-NPKYDHKASKEGIY-SGDPNIKKICHSGFEFENCLT
Smik_4.636         NKKRSLV-ATYMG--AGLISFSR-NQKNDSRMSKEGIY-SSDPNMKKICYSGFEFENWVT
YDR370C            NRQTSLI-VTYMG--AGLLSFCR-NVKKDSQMSKEGIY-SNDPNMKKICYSGFEFENWVT
Skud_4.639         NKRKSLI-VTYMG--AGLISFSR-NPKNDFQMSKEGIY-SSDPNMKKICYSGFEFEHWVT
KAFR0E03820        SKETIVN-STYLG--NGLLTFSQ--DTSDPMTMNEGIF-TKNKNLKKICYSGFALEDLLT
NDAI0B05690        MDDFILN-VTYKGGSNGMLLFSR----DVNKKDDGGIY-SKDGVVRKISYSGFALEDLLT
NCAS0F03400        VQDYVLN-VVYTGDETGRLLFTK-DWSNTGNSMNEGIY-SKNIILKRICYSGFALEDLMT
KLLA0E02245g       DEPLSLL-MTVQP--DKNILISV----DKSKDKPNGIHETRNSFNKKICYTGFALEDLLI
AER404C            NERCRLVFTAH----RGLFVITL-----APSQRPTGIN-SPSSATRKICYTGFELERLLT
SAKL0G02596g       LEEANLI-VTHL---DGLLIISS---DKSKPKVDSGIR-SKDTRVRKLCYTGFELENLVT
KLTH0F15994g       DEDVHFN-VKYI---NGYLHIFP---DKQFQKKDDGIY-SSESNIRRICYTGFELEDLVT
Kwal_55.21415      DEDVHLK-IQFS---NGYLNLSP---DAQYQKTDQGIH-SGDTKIKKICYTGFELENLIT
                                     : :                        . :  :*: :     

CAGL0A02860g       ESANDEERN-----------P----TFLIVENEIA-NTRLLMRCEIDAYNPITSHYTELK
KNAG0C04890        LNRGIIPS-----------------QFFYYGTPIRRGHLATFTCEMDAYNQIENHYTELK
TBLA0A02800        KDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDGYNPLTNSYTELK
TPHA0J02600        ENFQECHK------------P----YFYISENRLTPKSTFIIRSEMDSYNNKTETFTELK
ZYRO0F10098g       RGPRVEDD------------P----FFAIIEAELDANISLVLRCELDSYNELTETFTELK
Kpol_1016.4        EDIAENAR------------P----IFSVVESKLTESINLLLRNELDGYNNVTNMFTELK
TDEL0B02180        TSHDERMG------------P----FYSIVEGKINERLSLLLRCEMDAYNPIFNRYTELK
Suva_2.542         ENTKNSGSSASKC-------P----VFSIVEGKLSEDIGLLMRCEMDAFNPVSKTNTELK
Smik_4.636         EGIKAADLNGSKL-------P----VFSVVESKLSEEIGLLIRCEMDAFNPVSGANTELK
YDR370C            ENSKVADLTGSKC-------P----IFSLVESKLSEEIGLLIRCEMDAFNPVSETNTELK
Skud_4.639         EDIKATDLNGPKH-------P----IFSVVESKLSEDIGLLMRCEIDAFNPVSRTNTELK
KAFR0E03820        KSQKE---------------P----LFSITENQLDDNITLLLRCEMDAYNQLTQNYTELK
NDAI0B05690        TNKNDHNADNSDVTLVGGDKA----VFAIIENKLNDDISLLLRCEMDSYNPVNKCFTEMK
NCAS0F03400        ETTSELEKEGEKLT--GGEKA----VFAVVENKLDDDICILLRCELDAFNGAEKKFTELK
KLLA0E02245g       ESPTEGHILEHEL------------YYSIVHGSLNDEIDLLIQAEMDSINTLTDTYTEIK
AER404C            ATSGTERG------------S----FYSFIEAKLEPDITILLQCEMDAYNPKRQKYTEIK
SAKL0G02596g       KGKVDSPGMHT---------C----FYSIVENKLTEGVSLLLQAEMDSYNPKTDNYVELK
KLTH0F15994g       ETQPGAPKS-----------A----FYSLVQGKISKNIKLLFKAEMDCFNPAKRSYTEIK
Kwal_55.21415      ATSKPDVRS-----------S----FYSLVEGKLGDGIKLLLKAEMDCFNSSTRSYTEIK
                                             :      :       :  *:*  *      .*:*

CAGL0A02860g       CYAKYNFGNPNHRRKLLKSWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLIS
KNAG0C04890        CYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNAYDGTLQDITQLSRESLYRKFNN
TBLA0A02800        CFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDITWFSRDDLVTKCDS
TPHA0J02600        CFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILEDLLWYSRENMYQKLQD
ZYRO0F10098g       CYAPLNMHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKELYRKIND
Kpol_1016.4        CFAPLKC--MFSAKEVLKTWVQTGLIPESDIVIGIRDTQSGLLEDLVWYNRKDLCRTFNN
TDEL0B02180        CFTKLNVQDTAHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGSLYKKFNN
Suva_2.542         CFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLDIQWYSRDTLFRKFNH
Smik_4.636         CFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRDSLCMKFNH
YDR370C            CFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSGQLLDIQWYSRDLLCKKFNH
Skud_4.639         CFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRDSLYKKFNH
KAFR0E03820        CYAPLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEWYSRDGLYRRFNN
NDAI0B05690        CFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGELNDIEWFSRMNLYRQINN
NCAS0F03400        CFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFGELEDVEWYSRDRLRSKINN
KLLA0E02245g       SSVHFKLGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSYSNELEQLKAYKIQDIYHKINN
AER404C            SSVDFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEKLYI
SAKL0G02596g       CSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEIYKKFST
KLTH0F15994g       CTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQELYQKFNN
Kwal_55.21415      CSSGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYTRSQLYRKFNN
                   .             ::*. * *    *  :::.* *..    *  .   .   :      

CAGL0A02860g       KSLPRCD-SELNYDPAISVVWYRSLINTLTTTI-ASLLDKF---GRDEP--QLFSIKVDN
KNAG0C04890        KHQPRAH-TNFNYNAQVAVEWSQYAMKAIIRLI-EGNLNQK---SVLEP--QAFVVTVYR
TBLA0A02800        YYSPRLR-FHQNTTPTNASAWYYHVLSAITSLT-RDYLKKTPKAPSSVP--VPFRLIVEK
TPHA0J02600        PSLPKFK-NSFDFKPHIGIQWLNHCIHAIESAF-TKDTSD----TASNP--MTYKVIIDK
ZYRO0F10098g       RNLPKSP-KRFNYNADLAVQWCQHCIRSICKLV-GENVDR------SSP--QCFKLTIDE
Kpol_1016.4        PSLPPAP-SHFNFNANIAVEWLKFTMESIVSLV-SSSIAD-----SNHP--CSFKLKIDN
TDEL0B02180        PSIARNN-KYLNFNANIAVEWCFHCIESICDLVMKNSLSSP---DDPYPKYESFKVIVDK
Suva_2.542         PGLPLNK-KEMNYNAKVAVEWCKHCIKSICDLV-EANISRY---NCNKP--EPFEINIDA
Smik_4.636         SGLPSNK-RELNYNAKVAVEWCNHCIKSICELL-GANISDY---SCKNP--ESFEISIDS
YDR370C            PGLPTNK-KELNYNAQIAVEWCHYCIEAICKLV-EANISDY---SSTKP--ESFEIGIDT
Skud_4.639         PGLPPSK-KELNFNAKVAVEWCNHCIKSICELV-EANISHY---NSTRP--ESFEVSIDA
KAFR0E03820        RNLPENK-KSLNFNANIAVEWSHHCIKTICELI-SDNLQG------DAP--QAFQIKVDT
NDAI0B05690        RNLPEAK-LDLNYNAEIAVQWSQHCIKSICKLV-DESIDKT---RLNTS--QSFQIRINA
NCAS0F03400        RNLPESK-IDWNFNAQVATQWSQHCIRSICKLV-DENLDQK---AISNP--QGFQIRIDS
KLLA0E02245g       SSIVGKPGKFYKFNPNVANDWFQHIFQVLKQNL---LLLS----QESTS--TTFKVQIDT
AER404C            RDRTRSHPSYFNFNPEVAKDWTHYAIREICERL-SSLVDA----TSSSP--QSFLVEIDK
SAKL0G02596g       RNLNENR-KYYNFNSTVAVQWSHHVIAKITELV-DKNLTD-------EP-LQSFKLTLTR
KLTH0F15994g       RNLSLLK-KKYNYNANISVQWFRHLVKRLCQTI-TPYVEK----TPTEA--VSFKLTLTK
Kwal_55.21415      QRLTVMR-KNYNYNATISVQWFRHVIQQLCQMI-KPFIEK----GSKEE--VNFRLTLRK
                              .  .  .  *    .  :                        : : :  

CAGL0A02860g       NCNIRIEH-RQNPN---------------------------
KNAG0C04890        GHDIGIRKLKGVPKYA--EIPKEFI----------------
TBLA0A02800        NRTITLLPLKKVPASV--PIPDFYYKINVTESESSSPSTKR
TPHA0J02600        HKSIIIKKLSIVPKNV--EIPTDFL----------------
ZYRO0F10098g       SHKIQLEKLKHVPAHV--ELPIR------------------
Kpol_1016.4        HKTISIQKLSRIPQTVQRQIPKEFV----------------
TDEL0B02180        SHNIIVKKLTKVPRHV--QIPRAFR----------------
Suva_2.542         NGTIIITKLSTIPRNV--EIFKT------------------
Smik_4.636         NNTIAITKLKNIPKHV--ELFGTSIHV--------------
YDR370C            NNAIVITKLKTTPRNV--ELFGM------------------
Skud_4.639         NGTIAITKLNTVPKNV--ELFVT------------------
KAFR0E03820        FRNISIRNLSKIPQNA--QIPRQYL----------------
NDAI0B05690        SRAIQIKKLKSVPNNVTMYCKK-------------------
NCAS0F03400        RRNIRIKCLSKVPKDILEYL---------------------
KLLA0E02245g       NLTLSISPASQFVTALG------------------------
AER404C            NLQMKIRPTVVDYSELLGQWA--------------------
SAKL0G02596g       DLQLSLTKLANTPAGLIPEKFLNSRLAAK------------
KLTH0F15994g       QLELRLRKI-ETPSTAKESPKPKPAHAQS------------
Kwal_55.21415      NLTIKLRKMPETPAPTKGTIFKVPKKK--------------
                      : :                                   

FASTA FORMAT for MUSCLE Version 3.6

>CAGL0A02860g
-----------------MEEVVNQLEALSLSN-------------DKRRVKGQRKGKKKK
HGNSRARDDHTVVIRGNKQRLKTSHHKNMPQ-----FYDSAKTLGIFH---DHKLYEMNR
M--DLF-----PQLKDPIAHI--AKSTPAEKT--QLVRPFLGISLYENHDKYS-PMTAKE
LDTTEACSTYLDQYENSHG---QKYGEDRDFVIVTARHHMIDLAILPF---------SRQ
FTNVNLL-CAYTP--GNLLEISQ--DPADNTNDKVGVN-TDNPILKKICFSGFALEDILT
ESANDEERN-----------P----TFLIVENEIA-NTRLLMRCEIDAYNPITSHYTELK
CYAKYNFGNPNHRRKLLKSWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLIS
KSLPRCD-SELNYDPAISVVWYRSLINTLTTTI-ASLLDKF---GRDEP--QLFSIKVDN
NCNIRIEH-RQNPN---------------------------
>KNAG0C04890
--------MGTMTTAIETDDLLNSFHRLSIND----------------------------
------------QKRVRFKEFHHHDPGKYVSKPAH-IFQKSKEVACYT---GGKLYINDG
NTTNLT---ILPLLKEDIAAL---AQSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDM
LDSAKPCLDYINEWNRGSKGE-KKFGESYRHIIVGPRHHLVELTMALF----------AN
DSDYKLV-CTVLR--GKFIVLSQ-FDDGSQRNRNEGIT-LSDRRTRMLCYSGFVICKIWS
LNRGIIPS-----------------QFFYYGTPIRRGHLATFTCEMDAYNQIENHYTELK
CYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNAYDGTLQDITQLSRESLYRKFNN
KHQPRAH-TNFNYNAQVAVEWSQYAMKAIIRLI-EGNLNQK---SVLEP--QAFVVTVYR
GHDIGIRKLKGVPKYA--EIPKEFI----------------
>TBLA0A02800
-----------------MTNLEDNFSKMSLDG----------------NDKNSHNIHKLP
VCSHSLPGKKYQGGSIRFNSFVKPSKTHFSD-----LYRTSKEVATYH---LGNLNINTD
P--TIEHTKGVPCLKDDICQI--AGKSLLDSK--KYKAKYIGADLFKDYEKYH-AMEKEP
LHDPISCFKYIQYYDKKHANEKKKYGMDKEFVIITSRHHINDLVLAPF--------KKIS
DPEVSVL-LTYLG--DNRILLSQ-DYAHEPPDWRENKQ-FYNSM-RKIVNSGFAFEDLVI
KDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDGYNPLTNSYTELK
CFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDITWFSRDDLVTKCDS
YYSPRLR-FHQNTTPTNASAWYYHVLSAITSLT-RDYLKKTPKAPSSVP--VPFRLIVEK
NRTITLLPLKKVPASV--PIPDFYYKINVTESESSSPSTKR
>TPHA0J02600
MENANEGKNNTSLPEDNACILVEGLEKLSIDG-------------TTNVSRKNKAKKGKD
KKKSRGKYSDDIIARIPFKHFSYSNAHIGKSQPN--IFQEAKGVALYY---DKRITKITN
NEAELINESNPPFLTKDISNL--SEISLLDSK--KFKLPYMGYNLYDEIEKFG-PMDSTL
LDSTVPCFEYLRTLKISEED--KLYNT--PYTFMTPRHHLTELMMTVY---------ESR
ESELTGKSWLFTRIKDDLIVISE-DLAKENNPSPQNHK-LQNSFSKKVINSGFTFEELVI
ENFQECHK------------P----YFYISENRLTPKSTFIIRSEMDSYNNKTETFTELK
CFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILEDLLWYSRENMYQKLQD
PSLPKFK-NSFDFKPHIGIQWLNHCIHAIESAF-TKDTSD----TASNP--MTYKVIIDK
HKSIIIKKLSIVPKNV--EIPTDFL----------------
>ZYRO0F10098g
------------------------------------------------------------
MSHSKCSRNRAQLPSVPFNQFQHSSAFRFPSEPRN-LFTKYKEASYYY---GGQLHDSIS
D--SIG-------LKS-------PGNKLSHDRSCSNKRDFLGSDLYQGWEDFL-PLSPEI
LDSSRGCYQWINKWENDNH---TSYSQRSPFVVISPRHYLVELTMQLF-----------Q
QSKYSIL-CTHLG--DGKIVLSQ---VENDKKSHQHTS-RNTTMTKKILHSGYALEDLLT
RGPRVEDD------------P----FFAIIEAELDANISLVLRCELDSYNELTETFTELK
CYAPLNMHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKELYRKIND
RNLPKSP-KRFNYNADLAVQWCQHCIRSICKLV-GENVDR------SSP--QCFKLTIDE
SHKIQLEKLKHVPAHV--ELPIR------------------
>Kpol_1016.4
-------------MDEHINDVQTQLSNLKIGE----------------------DNPSRK
VKQNKSRPKKNVINIIPFHRFVHSNARSFPQKTKD-LFLESKTVAFFQ---KDQLFINVE
D--AAL-----PLLKKDIANI--SGKSVLNSK--KYKLPYLGSDLYASTDKYG-PLPEDV
LDSPKPCFDFIRHWENEHRG--EHYGAHADYTILSPRHHITEIVMSLF--------EDEK
NCSVYLL-CTYLK--NGIILLSKDDASSSSNSNTTGLN-SSNPMTRKICYSGFAFEDLVL
EDIAENAR------------P----IFSVVESKLTESINLLLRNELDGYNNVTNMFTELK
CFAPLKC--MFSAKEVLKTWVQTGLIPESDIVIGIRDTQSGLLEDLVWYNRKDLCRTFNN
PSLPPAP-SHFNFNANIAVEWLKFTMESIVSLV-SSSIAD-----SNHP--CSFKLKIDN
HKTISIQKLSRIPQTVQRQIPKEFV----------------
>TDEL0B02180
---MSKTSDSSTASSLEVHLLGNKLNSLGLQD-----------------------SPHGP
SKQRRKQQSGKRTVCIPFSKFEHSDLDYFPDDTAD-FFEGCEEVATYQ---NGYLFMKDS
SKKPLY-----PCLQM-------FAALIAENRGPKNKLPYIGCDLYQGHERYK-PLPSSE
LDSSIACFEYIKKWERRKIS--KSFNSG-KVTIISPRHHVVDLVMALF-----------H
DDEVSII-CTNIG--KGKLIFSG----DRSKEERNGLN-SKNSMTRKICYSGFALEDKLT
TSHDERMG------------P----FYSIVEGKINERLSLLLRCEMDAYNPIFNRYTELK
CFTKLNVQDTAHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGSLYKKFNN
PSIARNN-KYLNFNANIAVEWCFHCIESICDLVMKNSLSSP---DDPYPKYESFKVIVDK
SHNIIVKKLTKVPRHV--QIPRAFR----------------
>Suva_2.542
----------MSPEQDGVVKLAKDLEGINLRDVPNPVNEHRKKSSKRKIIPISSLKRPSS
QQKNDYLEEISEFTRVPYSSFLHTSIRNFPTKPPPDIFYESKEVALFT---DNQLYVAAR
K--DVI-----PNLKEDISHL--YESPLLEAR--KLKTLYLGLDLFANIDELV-PMTISE
LDTIAPCISYIEDWRLNNSG--KPFKIGKKFTVVTTRHHIVDLTMHPF---------DRR
NKQKSII-ATYMG--NGFISLSR-NPKYDHKASKEGIY-SGDPNIKKICHSGFEFENCLT
ENTKNSGSSASKC-------P----VFSIVEGKLSEDIGLLMRCEMDAFNPVSKTNTELK
CFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLDIQWYSRDTLFRKFNH
PGLPLNK-KEMNYNAKVAVEWCKHCIKSICDLV-EANISRY---NCNKP--EPFEINIDA
NGTIIITKLSTIPRNV--EIFKT------------------
>Smik_4.636
----------MPTEHDAVVRLTKELDGINLHSAPDIVREHQKKSFNWKTNSVSSLGNMSL
QQSENHINGHPKFTRVSYTSFSHSGMHKFPAKPPRDIFHESKEVALFT---NGQAYTTVR
K--DIL-----PNLKGDIAEL--CERSLLDAR--ERKLPYLGHDLFANIGQFV-PMTISE
LDSILPCISYIENWRLNNHG--EDFKIGRKFTVVTTRHHIVDMTMHLF---------DRR
NKKRSLV-ATYMG--AGLISFSR-NQKNDSRMSKEGIY-SSDPNMKKICYSGFEFENWVT
EGIKAADLNGSKL-------P----VFSVVESKLSEEIGLLIRCEMDAFNPVSGANTELK
CFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRDSLCMKFNH
SGLPSNK-RELNYNAKVAVEWCNHCIKSICELL-GANISDY---SCKNP--ESFEISIDS
NNTIAITKLKNIPKHV--ELFGTSIHV--------------
>YDR370C
----------MSTEQDAVLGLAKDLEGINLLTVPNLERGHQSKLCKEKTTSDSSSSRKPS
QQRDNYRKRRPKLICIPYTSFLHTGMHNFLTKPPRDIFHESKEVALFT---NGRAYTILR
K--DLI-----PNLKESIAEL--YESSLLEAK--KRKVPYLGHDLFANIDEFV-PMTISE
LDSVSPCFSYIENWILDNPG--KDFKIGKKFTVVTTRHHIVDLTMHLF---------NRR
NRQTSLI-VTYMG--AGLLSFCR-NVKKDSQMSKEGIY-SNDPNMKKICYSGFEFENWVT
ENSKVADLTGSKC-------P----IFSLVESKLSEEIGLLIRCEMDAFNPVSETNTELK
CFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSGQLLDIQWYSRDLLCKKFNH
PGLPTNK-KELNYNAQIAVEWCHYCIEAICKLV-EANISDY---SSTKP--ESFEIGIDT
NNAIVITKLKTTPRNV--ELFGM------------------
>Skud_4.639
----------MSTEDDPIARLTKNLESTNLNIVPDLVKGHQKRSSEGRSISITSSVKPPS
PQKDDYWNRCSRFKCVPYTSFVHTSIHDLSRKPPGDIFQDSKEVALFT---NYQAYTTAR
K--DLI-----PSLRDGITEL--YESSLLEAR--RRKVPYLGHDLFANIDQFV-PMTISE
LDSISPCISYVENWKLSNHG--KNFKIGKKFTIVSARHHIVDLTMHRF---------DRR
NKRKSLI-VTYMG--AGLISFSR-NPKNDFQMSKEGIY-SSDPNMKKICYSGFEFEHWVT
EDIKATDLNGPKH-------P----IFSVVESKLSEDIGLLMRCEIDAFNPVSRTNTELK
CFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRDSLYKKFNH
PGLPPSK-KELNFNAKVAVEWCNHCIKSICELV-EANISHY---NSTRP--ESFEVSIDA
NGTIAITKLNTVPKNV--ELFVT------------------
>KAFR0E03820
------------MAAASLNATIENFHGLSLGS----------------------------
------GKTQKTPIVSPFKRFQHRSIAYFPNHPAN-FFQISREVATYH---DGRIYEPNE
TSQDIL-----PLLNKDISKIA-QGVSAIDAR--KYKVKYIGSDLYQGFENFE-SMSREE
LDSALPCFAYIKKWEAHHH---CKYTENKKYTIVSARHHIVNLIMSIF----------DT
SKETIVN-STYLG--NGLLTFSQ--DTSDPMTMNEGIF-TKNKNLKKICYSGFALEDLLT
KSQKE---------------P----LFSITENQLDDNITLLLRCEMDAYNQLTQNYTELK
CYAPLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEWYSRDGLYRRFNN
RNLPENK-KSLNFNANIAVEWSHHCIKTICELI-SDNLQG------DAP--QAFQIKVDT
FRNISIRNLSKIPQNA--QIPRQYL----------------
>NDAI0B05690
--------MTTSTKPYDFTNLSRELNAVKEET----------------------------
-NASKEVITAPPITTIPFKQFKHCSISTYPKTPSS-FFETSKDVALYH---NKQLYSSDD
T--NLI-----PQLEPAIAKLANPSCSLNEAR--DLKLPYLGSDLYDGYESFI-PMDPDE
LDSIEPCFKYIESWELQNK---HDYQLGNKFTIVSARHHIVEMTMCIF--------NKRK
MDDFILN-VTYKGGSNGMLLFSR----DVNKKDDGGIY-SKDGVVRKISYSGFALEDLLT
TNKNDHNADNSDVTLVGGDKA----VFAIIENKLNDDISLLLRCEMDSYNPVNKCFTEMK
CFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGELNDIEWFSRMNLYRQINN
RNLPEAK-LDLNYNAEIAVQWSQHCIKSICKLV-DESIDKT---RLNTS--QSFQIRINA
SRAIQIKKLKSVPNNVTMYCKK-------------------
>NCAS0F03400
-----------------MKKTGQELMPLHTTV----------------------------
-----QSQKQAPITRVPFGEFSHSSISLFPTCTQP-FYESSNQVALYH---NHKLYPASQ
Y--DII-----PHLKNDIAQL--PKKSASEAR--TLKRSYLGSDLYDGFETFV-PMSAKD
LDSLEPCMSFIKDWERKAS---TKYKPGRKFNIVSTRHHIVEMTMKLFTGKTNNYNNTKK
VQDYVLN-VVYTGDETGRLLFTK-DWSNTGNSMNEGIY-SKNIILKRICYSGFALEDLMT
ETTSELEKEGEKLT--GGEKA----VFAVVENKLDDDICILLRCELDAFNGAEKKFTELK
CFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSSFGELEDVEWYSRDRLRSKINN
RNLPESK-IDWNFNAQVATQWSQHCIRSICKLV-DENLDQK---AISNP--QGFQIRIDS
RRNIRIKCLSKVPKDILEYL---------------------
>KLLA0E02245g
-----MTTVSCDKDENKVDQLGESLSQLRIST----------------------------
-RKNNKPSQKKGSLVLSCKKFPHVSVNYVVDKTPK-LLTDCKEVHNCSYIINDATLLWNE
A--SRK-----PRLRPEVCTY--IKDSKWENK--AVKDSFIGIDLTKGYDDYV-PLDRNV
LNSLVILKEAYQRYE-------KTLNPE-KTTFVSLRHHIIDIIMCPF-----------L
DEPLSLL-MTVQP--DKNILISV----DKSKDKPNGIHETRNSFNKKICYTGFALEDLLI
ESPTEGHILEHEL------------YYSIVHGSLNDEIDLLIQAEMDSINTLTDTYTEIK
SSVHFKLGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSYSNELEQLKAYKIQDIYHKINN
SSIVGKPGKFYKFNPNVANDWFQHIFQVLKQNL---LLLS----QESTS--TTFKVQIDT
NLTLSISPASQFVTALG------------------------
>AER404C
-------------MADDISTLAGKMRHLTLEK----------------------------
----------DLIVNVNMKKFPHGPITRRGKERSIRIFSESREVGTAFR--QGLVYDLDD
K--KNL-----PLLNDEICEY-------ISHRSKSKLIGYVGSDLSVESETFH-PVTSEE
LHCLHGLLKFIAKWEADNE---VNYASRSKFTIVSPRHHILDILMIPF-----------G
NERCRLVFTAH----RGLFVITL-----APSQRPTGIN-SPSSATRKICYTGFELERLLT
ATSGTERG------------S----FYSFIEAKLEPDITILLQCEMDAYNPKRQKYTEIK
SSVDFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEKLYI
RDRTRSHPSYFNFNPEVAKDWTHYAIREICERL-SSLVDA----TSSSP--QSFLVEIDK
NLQMKIRPTVVDYSELLGQWA--------------------
>SAKL0G02596g
-------------MTIPTDELTADISKLSLQH----------------------------
----------GSQNTANCKGFVHSNVSHFPSVPCK-FFQESREIGTFTRMVSSGKYLFDD
K--LGL-----RPLKDDICEY--IHNPAKNAS--KIKTQYLGYDLLNGFEDYI-PLSEDE
LNNMDGILNFIGNWEEKNG---KKYGSENKFTIVSNRHHLIDLIMCPF-----------S
LEEANLI-VTHL---DGLLIISS---DKSKPKVDSGIR-SKDTRVRKLCYTGFELENLVT
KGKVDSPGMHT---------C----FYSIVENKLTEGVSLLLQAEMDSYNPKTDNYVELK
CSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEIYKKFST
RNLNENR-KYYNFNSTVAVQWSHHVIAKITELV-DKNLTD-------EP-LQSFKLTLTR
DLQLSLTKLANTPAGLIPEKFLNSRLAAK------------
>KLTH0F15994g
--------------------MQKLFEKLSLED----------------------------
---------LPDEACVSCRGFERASISHFPAEPLH-FFDEVKEIGTMTHWIDSDKFELGR
K--QSA-----PHLKKDLGLFTITKKLAKTNS-------YVGHDLLEHYDDFQ-PLTPNQ
LEDMSGVFEFLNKWEGDHG---KPYSSGSDFTIVCSRHNLIDLIMAPF-----------S
DEDVHFN-VKYI---NGYLHIFP---DKQFQKKDDGIY-SSESNIRRICYTGFELEDLVT
ETQPGAPKS-----------A----FYSLVQGKISKNIKLLFKAEMDCFNPAKRSYTEIK
CTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQELYQKFNN
RNLSLLK-KKYNYNANISVQWFRHLVKRLCQTI-TPYVEK----TPTEA--VSFKLTLTK
QLELRLRKI-ETPSTAKESPKPKPAHAQS------------
>Kwal_55.21415
--------------------MLPNLQDLSLQD----------------------------
---------RTEEVHANCKNFQHAQINQFPKNVLP-FFDEVQEVATITHLLDTDEFLLDD
K--LGM-----PELVQDLCEF--TESGKLANK-----GKYIGHDLLDHFDEYV-PITPKQ
LEDMAGVQAFLERWKQLHG---RSFCDNADFTIVCSRHNLIDLIMMPF-----------S
DEDVHLK-IQFS---NGYLNLSP---DAQYQKTDQGIH-SGDTKIKKICYTGFELENLIT
ATSKPDVRS-----------S----FYSLVEGKLGDGIKLLLKAEMDCFNSSTRSYTEIK
CSSGLKVKSTYHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYTRSQLYRKFNN
QRLTVMR-KNYNYNATISVQWFRHVIQQLCQMI-KPFIEK----GSKEE--VNFRLTLRK
NLTIKLRKMPETPAPTKGTIFKVPKKK--------------