MUSCLE (3.8) multiple sequence alignment

AER401W            MSTKATL---------KASTDTVTLNTGAKIPLFGLGTWQS-TDDDASSAVAAALKHGYK
KLTH0F16060g       --MTTVL---------KKCTATAKLNTGAQIPLLGLGTWRS-TKENGYNATLAAIKAGYR
Kwal_55.21426      --MTGIL---------KKCTATATLNTGAKIPLLGLGTWRL-TKEGGYKAILAALKAGYR
ZYRO0F10032g       ---MVTL---------QNSTSTLKLNTGQTIPQVGLGTWRS-KENEGYKAVIEALKAGYR
TBLA0A06510        --MPAQL---------KNSDTYVTLNNGEKIPSVGLGTWKS-QENDGYNSVIYALKAGYR
TDEL0E01910        --MSATL---------SNNTSTVKLNTGYTIPQVGLGTWRS-KEGDGYKAVTAALKAGYR
KAFR0E03840        --MSANL---------KNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYR
CAGL0A02816g       ----MSL---------KNSTATLKLNTGAEIPVVGLGTWRS-AANDGYDSVLAALKLGYR
SAKL0G02530g       --MSIQL---------KNSSATVKLNTGAIIPQLGLGTWRS-SDEEAYNSVLSAIKLGYR
Smik_4.634         --MPATL---------KNSSASLKLNTGASIPVLGFGTWRS-VENNGYHSVIAALKAGYR
Suva_2.540         --MPATL---------KNSSATLKLNTGASIPVLGFGTWRS-VDNSGYHSVIAALKAGYR
YDR368W            --MPATL---------KNSSATLKLNTGASIPVLGFGTWRS-VDNNGYHSVIAALKAGYR
Skud_4.637         --MPATL---------RNSSATLKLNTGASIPALGFGTWRS-VDNNGYHSVIAALKTGYR
TPHA0E01760        ----MTL---------SNSTAKVTLNDGNQLPYVGLGTWQS-KENDAYKAVVAALKAGYR
NDAI0B05670        ---MPSP---------QVSENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYR
NCAS0F03380        --MTVTL---------KASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYR
Kpol_1062.29       ----MSL---------KNCETRVKLNTGAELPAVGLGTWQS-LENDAYKAVLTALKTGYR
CAGL0I01100g       ---MAAL---------HKNTSTLKLNTGAHIPVIGLGTWQS-SENEGYNATLEALKAGYR
NDAI0C01600        --MGSTL---------KNSTATYKLNTGATIPAVGLGTWQSTNENEGYEAVMNALKAGYR
NCAS0H02060        --MPTSIAKHEKQMSASNSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYR
KNAG0C04910        --MSATL---------SKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYR
Smik_15.298        --MSTTL---------HDSTKTLSLNTGAQIPQVGLGTWQS-KDNDAYKSVLAALKAGYK
YOR120W            --MPATL---------HDSTKILSLNTGAQIPQIGLGTWQS-KENDAYKAVLTALKDGYR
Suva_8.173         --MSATL---------QYSTKTLPLNTGAKIPQVGLGTWQS-KDNDAYKSVVAALKDGYR
Skud_15.283        --MPATL---------QDSTRTLSLNTGAQIPQVGLGTWQS-KDNDAYKSVLAALKDGYR
                                           *. *  :  ..:***.      .  :   *:  **.

AER401W            HIDTASFYKNEELVGKAVKESGIPREELFITTKVWNDQQRDPAGALDLSLKKLGTEYVDL
KLTH0F16060g       HIDIAAVCMNEQVVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDL
Kwal_55.21426      HIDSAAVCMNEQVIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDL
ZYRO0F10032g       HIDGAAVYGNEGEVGKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDL
TBLA0A06510        HIDTAAIYRNEGEVGRAIKDSGVPRDQIFITTKLWCTEFQNPKRALESSLKRLGLDYVDL
TDEL0E01910        HIDGAAIYLNEEEVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDL
KAFR0E03840        HIDTAAIYKNEVQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDL
CAGL0A02816g       HIDAAAIYGNEDQVGRAIKDSGVPRQEIFITTKLWGTEHRNPAKALDSSLKRLGLDYVDL
SAKL0G02530g       HIDSAAIYGNEEPVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDL
Smik_4.634         HIDAAAIYLNEEEVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDL
Suva_2.540         HIDAAAIYLNEEEVGKAIKDSGVPREEIFITTKLWGTEQRDPEAALDKSLKRLGLDYVDL
YDR368W            HIDAAAIYLNEEEVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDL
Skud_4.637         HIDAAAIYLNEEEVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDL
TPHA0E01760        HIDTAAIYGNEEEVGRAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDL
NDAI0B05670        HIDTAAIYGNEAQVGKAIRDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDL
NCAS0F03380        HIDTAAIYGNEDQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDL
Kpol_1062.29       HIDGAAIYCNEGEVGKAIRDSGVPRNEIFVTTKLWGTQQRTPQLALEQSLERLGLDYVDL
CAGL0I01100g       HIDTAAIYKNEEEIGRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDL
NDAI0C01600        HIDTAAIYKNEDQVGKAINDSGIPREEIFVTTKLWGTQHRDPETALNQSLERLGLDYVDL
NCAS0H02060        HIDTAAIYGNEGQVGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDL
KNAG0C04910        HIDTAAIYGNEAEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDL
Smik_15.298        HIDTAAIYRNEDQVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDL
YOR120W            HIDTAAIYRNEDQVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDL
Suva_8.173         HIDTAAIYGNEDQVGQAIKDSGVPREEIFVTTKLWCTQHHEPAKALDQSLKRLGLDYVDL
Skud_15.283        HIDTAAIYRNEDQVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDL
                   *** *:.  **  :* *:.:*.: * .:*:*:*:*  : . *  .*. :* .** :*:**

AER401W            LLMHWPVPFKEPENST-LD-----AYKVPRGPDGKVTRD-EEWDFVKTWHLMQKLLGTGK
KLTH0F16060g       YMMHWPVAFRSEQVKH-TN-----YMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGK
Kwal_55.21426      YMMHWPLAFRVDQIKA-KN-----FMLIPRNSEGKPYVD-TDWDYVKTWELMQKLP-TEK
ZYRO0F10032g       YLIHWPVPLRTENIKD-GN-----LFQFAEKPDGSKDVDL-EWNFIKTWELMQKLLESGK
TBLA0A06510        YLMHWPVVLNPRYIKD-DD-----YLVVPRLPDGTRDVDMETWDYIKTWELVQELPATGL
TDEL0E01910        YLMHWPVPLKTKRITD-GN-----LLSSPAKEDGKPDVD-TEWDFVKTWELMQELPKTKK
KAFR0E03840        YLMHWPVSLDKSYMKE--S-----PLELMKRPDGTRPVE-TDWTFINTWELMQKLPKN-K
CAGL0A02816g       YLMHWPVALKAHGSEE-KD-----LLNIPKKPDGKTDIDIEDWDFIKTWELMQELPKTGK
SAKL0G02530g       YLIHWPIAFKTDNIKD-DD-----YLTVPTGKDGKADVDVKDWNFVKTWELVQELPATGK
Smik_4.634         YLMHWPVPLKTETITD-GN-----VLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGK
Suva_2.540         YLMHWPVPLKTDTITD-GD-----FLCIPTLEDGTIDVDTKEWNFVKTWDLMQKLPKTGK
YDR368W            YLMHWPVPLKTDRVTD-GN-----VLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGK
Skud_4.637         YLMHWPVPLKTDTVTD-GN-----VLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGK
TPHA0E01760        YLMHWPVPINDAQCKKDNN-----YLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-K
NDAI0B05670        YLMHWPVTFNPRSIKD-EDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGK
NCAS0F03380        YLMHWPVTFNTRNVKG-TD-----FMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGM
Kpol_1062.29       YLIHWPIPLNPAQCEESGN-----YLTFPGLPNGKRDVDLDTWNFVKTWELMQELPATGK
CAGL0I01100g       YLMHWPVALKTDLIKD-GN-----LLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-K
NDAI0C01600        YLMHWPVAFKPDSIKD-GN-----YSTMPMLPNGQRDLDLTTWNFVKTWELMQELPKTGK
NCAS0H02060        YLMHWPVTLNPRSIKD-GN-----FLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGK
KNAG0C04910        YLMHWPVRMRGENMPE-GD-----KIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGK
Smik_15.298        YLIHWPARLDTNYIKD-GD-----ILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGK
YOR120W            YLMHWPARLDPAYIKN-ED-----ILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGK
Suva_8.173         YLMHWPVRLDPNYIKD-GH-----ILSIPTKEDGSRPVDITNWNFIKTWELMQELPKTNK
Skud_15.283        YLMHWPVRLDPDYIKD-GN-----ILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGK
                    ::***  :                       :*    :   * :::** *:* *     

AER401W            VKAIGVSNFSINNLEELLNAEGTTVVPAVNQVELHIRLPQLELVEYCQKKGIVVEAYSPL
KLTH0F16060g       TNALGVANFSVSQLKKLIDSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPL
Kwal_55.21426      TRAIGVANFSVPQLTSLLKSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPL
ZYRO0F10032g       TKAIGVSNFSVNNLKDLLAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPL
TBLA0A06510        TRSVGVSNFSINNLEKVLSSPGNKLTPAVNQVELHPLLPQFELQKYCDSKKIKLEAYSPF
TDEL0E01910        ARSVGVSNFSINNLKELLASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPL
KAFR0E03840        VRSIGVSNFSVNNLKDLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPL
CAGL0A02816g       TKAIGVSNFSINNLKALKNSPKFNTVPAANQVEIHPLFPQTELIEYCKSENILIEAYSPF
SAKL0G02530g       AKAVGVSNFSVNNLKELLASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPL
Smik_4.634         TKAVGVSNFSINNIKALLESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPF
Suva_2.540         TKAVGVSNFSINNIKELLKSPSNKLVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPF
YDR368W            TKAVGVSNFSINNIKELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPF
Skud_4.637         TRAVGVSNFSINNIKELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPF
TPHA0E01760        VKSIGVSNFSINNIKDLLASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPL
NDAI0B05670        TKAVGVSNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPF
NCAS0F03380        TKAVGVSNFSINNLKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPL
Kpol_1062.29       CKAVGVSNFSINNIKELLSSPGNKLVPAVNQIELHPLLPQVELVNFCKEKGIVVEAYSPL
CAGL0I01100g       ARAIGVSNFSINNLKELLNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPL
NDAI0C01600        TRAVGVSNFSINNLKALLSSPGNKLVPAANQVEAHPLLPQDELQKFCKEKGIILEAYSPL
NCAS0H02060        TRAVGVSNFSINNLKKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPL
KNAG0C04910        TRAIGVSNFSINNLKDLLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPL
Smik_15.298        TKAIGVSNFSINNLKDLLASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPL
YOR120W            TKAVGVSNFSINNLKDLLASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPL
Suva_8.173         TRAVGVSNFSINNLKDLLASPGNQLTPAANQVELHPLLPQNELIDFCKSKGIMVEAYSPL
Skud_15.283        AKAVGVSNFSINNLKDLLASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPL
                    .::**:***: ::  :  :      *.  *:* *  :.   :  :     * :*.***:

AER401W            GSSSAPLLKDATVNKVAEKYGVTPAHVLLNYVANR-GIVVLPKSVKESRIISNFEYFKMD
KLTH0F16060g       GSEGAPLLDEPVVREISKKLHVEPAQLLVSWGLQR-GHAVLVKSKTPSRIEANLHTFDIP
Kwal_55.21426      GGDGGPLIDEPVIREISKKLHVEPAQLLISWGLKR-GCAVLPKSKTQTRIESNLEVFDLS
ZYRO0F10032g       GGENAPILSDPTVQEIAKANGVEAGHVVISWAVQK-GLVTLPKSVTPSRIVGNLKVLTLS
TBLA0A06510        GSDNAPNLKQKTIVDIAAKNGVSPAQVITSWIVQR-DIVVLPKSVHEERVISNFKVFDLS
TDEL0E01910        GGHGAPVLDDPIIKQIADRHNADAGNVVVSWGVQR-GIVTLPKSTTPERVVSNLRTFKLS
KAFR0E03840        GSTSAPLLSEPIVIDVAKKNGVQPAHVVLSWIVQR-NIIVLPKSVHAERVAANLKTFTLP
CAGL0A02816g       GSADAPVLKEPELHKLAEKYNISTAQLIISWSVQR-GYVVLPKSVHAERIEANLKVLTLK
SAKL0G02530g       GSNGSPLLKEPVIIEVAKKYGVEPAQVLINWGIQR-GYVILPKSVNPKRVESNFKVFDLS
Smik_4.634         GSVNAPLLEEQAIIDMAKKHGVAPAQLIISWSIQR-GYVVLAKSVNPERIVSNFKIFTLP
Suva_2.540         GSANAPLLKEQAIIDMAKKHGVEPAQLIISWSIQR-GYVVLAKSVNPERVVSNFKIFTLP
YDR368W            GSANAPLLKEQAIIDMAKKHGVEPAQLIISWSIQR-GYVVLAKSVNPERIVSNFKIFTLP
Skud_4.637         GSANAPLLKEQAIIDMAKKHGVEPSQLIISWSIQR-GYVVLAKSVNPERVVSNFKIFTLP
TPHA0E01760        GSTGAPILELGTINEVSKKLAIPPANVVFSWLIQR-KIVVLPKSVTESRIISNLQTMELP
NDAI0B05670        GSINAPILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLP
NCAS0F03380        GSINAPILKEPKIIEISKKLDVPPAQLIISWHVQR-GYVVLVKSTHEERIIANRKVFTLS
Kpol_1062.29       GGTGAAILKEPLVEELAKKYNIPAANLVVSWDVQR-GVVVLPKSVTESRIISNLQTLTLA
CAGL0I01100g       GSTDAPILKEEEITEIAKKNGVNAGQLVISWHAQR-GYVVLPKSVKPERIHGNQETFKLS
NDAI0C01600        GSTNAPILTEPKIIEIAKKHNVQPAQVVISWHVQK-GHVVLPKSVHEERIKANFQTFELS
NCAS0H02060        GSTNAPILTEPVLINLAKKHGVQTAQIVISWHVQR-GYIVLPKSVHAERIQANFKTLKLS
KNAG0C04910        GSADAPILKEPVIIEIAKKNGVSAAQVVISWNVQR-GYIVLPKSVNKERIEANLLTFTLT
Smik_15.298        GSTDAPLLKEPTILKIAKKNNVQPGHVVISWHAQR-GYVVLPKSVNPDRIETNRKIFTLS
YOR120W            GSTDAPLLKEPVILEIAKKNNVQPGHVVISWHVQR-GYVVLPKSVNPDRIKTNRKIFTLS
Suva_8.173         GSTDAPLLKEPVVLEIAKKNNVQPGHVVISWHAQR-GYVVLPKSVNPDRIKTNRKVFTLS
Skud_15.283        GSTDAPLLKEPVILEIAKKNNVQPAHVVISWHAQR-GYVVLPKSVNPDRVKANRKIFTLS
                   *. ... :    :  ::       .::: .:  :.     * **    *:  *   . : 

AER401W            EEDIKLLNDIHKKEGVQRFVDPDFSPFPLFQ
KLTH0F16060g       EGDLRRINELAQERGTKRIHNPTWFSFEE--
Kwal_55.21426      DEDYERIHEIAQERGPKRTHNPPWFSFEE--
ZYRO0F10032g       DSDVAKVDGLLKAKGERRTCYQDFSPFPIFQ
TBLA0A06510        KEDIAEIDALAKVNGEKRINKPDWDPFPVFE
TDEL0E01910        DEEMGSINNLSKSRGQKRTNAPDMSPFPLFE
KAFR0E03840        EEDFDAIGKISQQRGERRINNPNFEPFKTFV
CAGL0A02816g       DEDMETITNLSKVKGEKRLVQLDWSPFPTFE
SAKL0G02530g       KEDVDRIHKISKEQGVKRFVHPDWPSFPIFE
Smik_4.634         EDDFKIISNLSKVHGEKRVVDMKWSSFPIFK
Suva_2.540         EDDFKTISNLSKVHGEKRVVNMQWNSFPIFE
YDR368W            EDDFKTISNLSKVHGTKRVVDMKWGSFPIFQ
Skud_4.637         EDDFKAIGDLSKVHGEKRVVNMKWASFPIFE
TPHA0E01760        AEEFSKLNNISSEVGEKRSVKPNWTPFIPFV
NDAI0B05670        DEDFQAINNLVKEKGELRVVDPDWSPFPLFK
NCAS0F03380        KEDFEAIKNLAKEKGTLRVVDPDWSPFPLFK
Kpol_1062.29       PEDVEKITNLSKEKGEKRTCAPDFSPFNTFA
CAGL0I01100g       DEDFATLSNYAKKHGERRVVSPNWGPFKPFV
NDAI0C01600        KDEMDSLNNLSKEKGERRIVQPNWAPFVPFV
NCAS0H02060        DEEMREINNISKEKGERRIVQPHWEPFVPFV
KNAG0C04910        SEDFEAVNNISKVQGTKRIIDPDWEPFKPFV
Smik_15.298        NEDFEAINNISKEKGEKRVVNPNWSPFEAFK
YOR120W            TEDFEAINNISKEKGEKRVVHPNWSPFEVFK
Suva_8.173         DEDFEAINNISKEKGEKRVVNPDWSPFEAFK
Skud_15.283        DEDFEAINGISKAKGEKRVVHPNWSPFEAFK
                     :   :    .  *  *       .*    

FASTA FORMAT for MUSCLE Version 3.6

>AER401W
MSTKATL---------KASTDTVTLNTGAKIPLFGLGTWQS-TDDDASSAVAAALKHGYK
HIDTASFYKNEELVGKAVKESGIPREELFITTKVWNDQQRDPAGALDLSLKKLGTEYVDL
LLMHWPVPFKEPENST-LD-----AYKVPRGPDGKVTRD-EEWDFVKTWHLMQKLLGTGK
VKAIGVSNFSINNLEELLNAEGTTVVPAVNQVELHIRLPQLELVEYCQKKGIVVEAYSPL
GSSSAPLLKDATVNKVAEKYGVTPAHVLLNYVANR-GIVVLPKSVKESRIISNFEYFKMD
EEDIKLLNDIHKKEGVQRFVDPDFSPFPLFQ
>KLTH0F16060g
--MTTVL---------KKCTATAKLNTGAQIPLLGLGTWRS-TKENGYNATLAAIKAGYR
HIDIAAVCMNEQVVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDL
YMMHWPVAFRSEQVKH-TN-----YMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGK
TNALGVANFSVSQLKKLIDSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPL
GSEGAPLLDEPVVREISKKLHVEPAQLLVSWGLQR-GHAVLVKSKTPSRIEANLHTFDIP
EGDLRRINELAQERGTKRIHNPTWFSFEE--
>Kwal_55.21426
--MTGIL---------KKCTATATLNTGAKIPLLGLGTWRL-TKEGGYKAILAALKAGYR
HIDSAAVCMNEQVIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDL
YMMHWPLAFRVDQIKA-KN-----FMLIPRNSEGKPYVD-TDWDYVKTWELMQKLP-TEK
TRAIGVANFSVPQLTSLLKSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPL
GGDGGPLIDEPVIREISKKLHVEPAQLLISWGLKR-GCAVLPKSKTQTRIESNLEVFDLS
DEDYERIHEIAQERGPKRTHNPPWFSFEE--
>ZYRO0F10032g
---MVTL---------QNSTSTLKLNTGQTIPQVGLGTWRS-KENEGYKAVIEALKAGYR
HIDGAAVYGNEGEVGKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDL
YLIHWPVPLRTENIKD-GN-----LFQFAEKPDGSKDVDL-EWNFIKTWELMQKLLESGK
TKAIGVSNFSVNNLKDLLAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPL
GGENAPILSDPTVQEIAKANGVEAGHVVISWAVQK-GLVTLPKSVTPSRIVGNLKVLTLS
DSDVAKVDGLLKAKGERRTCYQDFSPFPIFQ
>TBLA0A06510
--MPAQL---------KNSDTYVTLNNGEKIPSVGLGTWKS-QENDGYNSVIYALKAGYR
HIDTAAIYRNEGEVGRAIKDSGVPRDQIFITTKLWCTEFQNPKRALESSLKRLGLDYVDL
YLMHWPVVLNPRYIKD-DD-----YLVVPRLPDGTRDVDMETWDYIKTWELVQELPATGL
TRSVGVSNFSINNLEKVLSSPGNKLTPAVNQVELHPLLPQFELQKYCDSKKIKLEAYSPF
GSDNAPNLKQKTIVDIAAKNGVSPAQVITSWIVQR-DIVVLPKSVHEERVISNFKVFDLS
KEDIAEIDALAKVNGEKRINKPDWDPFPVFE
>TDEL0E01910
--MSATL---------SNNTSTVKLNTGYTIPQVGLGTWRS-KEGDGYKAVTAALKAGYR
HIDGAAIYLNEEEVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDL
YLMHWPVPLKTKRITD-GN-----LLSSPAKEDGKPDVD-TEWDFVKTWELMQELPKTKK
ARSVGVSNFSINNLKELLASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPL
GGHGAPVLDDPIIKQIADRHNADAGNVVVSWGVQR-GIVTLPKSTTPERVVSNLRTFKLS
DEEMGSINNLSKSRGQKRTNAPDMSPFPLFE
>KAFR0E03840
--MSANL---------KNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYR
HIDTAAIYKNEVQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDL
YLMHWPVSLDKSYMKE--S-----PLELMKRPDGTRPVE-TDWTFINTWELMQKLPKN-K
VRSIGVSNFSVNNLKDLLKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPL
GSTSAPLLSEPIVIDVAKKNGVQPAHVVLSWIVQR-NIIVLPKSVHAERVAANLKTFTLP
EEDFDAIGKISQQRGERRINNPNFEPFKTFV
>CAGL0A02816g
----MSL---------KNSTATLKLNTGAEIPVVGLGTWRS-AANDGYDSVLAALKLGYR
HIDAAAIYGNEDQVGRAIKDSGVPRQEIFITTKLWGTEHRNPAKALDSSLKRLGLDYVDL
YLMHWPVALKAHGSEE-KD-----LLNIPKKPDGKTDIDIEDWDFIKTWELMQELPKTGK
TKAIGVSNFSINNLKALKNSPKFNTVPAANQVEIHPLFPQTELIEYCKSENILIEAYSPF
GSADAPVLKEPELHKLAEKYNISTAQLIISWSVQR-GYVVLPKSVHAERIEANLKVLTLK
DEDMETITNLSKVKGEKRLVQLDWSPFPTFE
>SAKL0G02530g
--MSIQL---------KNSSATVKLNTGAIIPQLGLGTWRS-SDEEAYNSVLSAIKLGYR
HIDSAAIYGNEEPVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDL
YLIHWPIAFKTDNIKD-DD-----YLTVPTGKDGKADVDVKDWNFVKTWELVQELPATGK
AKAVGVSNFSVNNLKELLASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPL
GSNGSPLLKEPVIIEVAKKYGVEPAQVLINWGIQR-GYVILPKSVNPKRVESNFKVFDLS
KEDVDRIHKISKEQGVKRFVHPDWPSFPIFE
>Smik_4.634
--MPATL---------KNSSASLKLNTGASIPVLGFGTWRS-VENNGYHSVIAALKAGYR
HIDAAAIYLNEEEVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDL
YLMHWPVPLKTETITD-GN-----VLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGK
TKAVGVSNFSINNIKALLESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPF
GSVNAPLLEEQAIIDMAKKHGVAPAQLIISWSIQR-GYVVLAKSVNPERIVSNFKIFTLP
EDDFKIISNLSKVHGEKRVVDMKWSSFPIFK
>Suva_2.540
--MPATL---------KNSSATLKLNTGASIPVLGFGTWRS-VDNSGYHSVIAALKAGYR
HIDAAAIYLNEEEVGKAIKDSGVPREEIFITTKLWGTEQRDPEAALDKSLKRLGLDYVDL
YLMHWPVPLKTDTITD-GD-----FLCIPTLEDGTIDVDTKEWNFVKTWDLMQKLPKTGK
TKAVGVSNFSINNIKELLKSPSNKLVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPF
GSANAPLLKEQAIIDMAKKHGVEPAQLIISWSIQR-GYVVLAKSVNPERVVSNFKIFTLP
EDDFKTISNLSKVHGEKRVVNMQWNSFPIFE
>YDR368W
--MPATL---------KNSSATLKLNTGASIPVLGFGTWRS-VDNNGYHSVIAALKAGYR
HIDAAAIYLNEEEVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDL
YLMHWPVPLKTDRVTD-GN-----VLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGK
TKAVGVSNFSINNIKELLESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPF
GSANAPLLKEQAIIDMAKKHGVEPAQLIISWSIQR-GYVVLAKSVNPERIVSNFKIFTLP
EDDFKTISNLSKVHGTKRVVDMKWGSFPIFQ
>Skud_4.637
--MPATL---------RNSSATLKLNTGASIPALGFGTWRS-VDNNGYHSVIAALKTGYR
HIDAAAIYLNEEEVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDL
YLMHWPVPLKTDTVTD-GN-----VLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGK
TRAVGVSNFSINNIKELLKSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPF
GSANAPLLKEQAIIDMAKKHGVEPSQLIISWSIQR-GYVVLAKSVNPERVVSNFKIFTLP
EDDFKAIGDLSKVHGEKRVVNMKWASFPIFE
>TPHA0E01760
----MTL---------SNSTAKVTLNDGNQLPYVGLGTWQS-KENDAYKAVVAALKAGYR
HIDTAAIYGNEEEVGRAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDL
YLMHWPVPINDAQCKKDNN-----YLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-K
VKSIGVSNFSINNIKDLLASPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPL
GSTGAPILELGTINEVSKKLAIPPANVVFSWLIQR-KIVVLPKSVTESRIISNLQTMELP
AEEFSKLNNISSEVGEKRSVKPNWTPFIPFV
>NDAI0B05670
---MPSP---------QVSENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYR
HIDTAAIYGNEAQVGKAIRDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDL
YLMHWPVTFNPRSIKD-EDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGK
TKAVGVSNFSINNLNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPF
GSINAPILKDETINAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLP
DEDFQAINNLVKEKGELRVVDPDWSPFPLFK
>NCAS0F03380
--MTVTL---------KASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYR
HIDTAAIYGNEDQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDL
YLMHWPVTFNTRNVKG-TD-----FMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGM
TKAVGVSNFSINNLKELLTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPL
GSINAPILKEPKIIEISKKLDVPPAQLIISWHVQR-GYVVLVKSTHEERIIANRKVFTLS
KEDFEAIKNLAKEKGTLRVVDPDWSPFPLFK
>Kpol_1062.29
----MSL---------KNCETRVKLNTGAELPAVGLGTWQS-LENDAYKAVLTALKTGYR
HIDGAAIYCNEGEVGKAIRDSGVPRNEIFVTTKLWGTQQRTPQLALEQSLERLGLDYVDL
YLIHWPIPLNPAQCEESGN-----YLTFPGLPNGKRDVDLDTWNFVKTWELMQELPATGK
CKAVGVSNFSINNIKELLSSPGNKLVPAVNQIELHPLLPQVELVNFCKEKGIVVEAYSPL
GGTGAAILKEPLVEELAKKYNIPAANLVVSWDVQR-GVVVLPKSVTESRIISNLQTLTLA
PEDVEKITNLSKEKGEKRTCAPDFSPFNTFA
>CAGL0I01100g
---MAAL---------HKNTSTLKLNTGAHIPVIGLGTWQS-SENEGYNATLEALKAGYR
HIDTAAIYKNEEEIGRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDL
YLMHWPVALKTDLIKD-GN-----LLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-K
ARAIGVSNFSINNLKELLNSKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPL
GSTDAPILKEEEITEIAKKNGVNAGQLVISWHAQR-GYVVLPKSVKPERIHGNQETFKLS
DEDFATLSNYAKKHGERRVVSPNWGPFKPFV
>NDAI0C01600
--MGSTL---------KNSTATYKLNTGATIPAVGLGTWQSTNENEGYEAVMNALKAGYR
HIDTAAIYKNEDQVGKAINDSGIPREEIFVTTKLWGTQHRDPETALNQSLERLGLDYVDL
YLMHWPVAFKPDSIKD-GN-----YSTMPMLPNGQRDLDLTTWNFVKTWELMQELPKTGK
TRAVGVSNFSINNLKALLSSPGNKLVPAANQVEAHPLLPQDELQKFCKEKGIILEAYSPL
GSTNAPILTEPKIIEIAKKHNVQPAQVVISWHVQK-GHVVLPKSVHEERIKANFQTFELS
KDEMDSLNNLSKEKGERRIVQPNWAPFVPFV
>NCAS0H02060
--MPTSIAKHEKQMSASNSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYR
HIDTAAIYGNEGQVGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDL
YLMHWPVTLNPRSIKD-GN-----FLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGK
TRAVGVSNFSINNLKKVLSSPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPL
GSTNAPILTEPVLINLAKKHGVQTAQIVISWHVQR-GYIVLPKSVHAERIQANFKTLKLS
DEEMREINNISKEKGERRIVQPHWEPFVPFV
>KNAG0C04910
--MSATL---------SKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYR
HIDTAAIYGNEAEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDL
YLMHWPVRMRGENMPE-GD-----KIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGK
TRAIGVSNFSINNLKDLLASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPL
GSADAPILKEPVIIEIAKKNGVSAAQVVISWNVQR-GYIVLPKSVNKERIEANLLTFTLT
SEDFEAVNNISKVQGTKRIIDPDWEPFKPFV
>Smik_15.298
--MSTTL---------HDSTKTLSLNTGAQIPQVGLGTWQS-KDNDAYKSVLAALKAGYK
HIDTAAIYRNEDQVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDL
YLIHWPARLDTNYIKD-GD-----ILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGK
TKAIGVSNFSINNLKDLLASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPL
GSTDAPLLKEPTILKIAKKNNVQPGHVVISWHAQR-GYVVLPKSVNPDRIETNRKIFTLS
NEDFEAINNISKEKGEKRVVNPNWSPFEAFK
>YOR120W
--MPATL---------HDSTKILSLNTGAQIPQIGLGTWQS-KENDAYKAVLTALKDGYR
HIDTAAIYRNEDQVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDL
YLMHWPARLDPAYIKN-ED-----ILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGK
TKAVGVSNFSINNLKDLLASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPL
GSTDAPLLKEPVILEIAKKNNVQPGHVVISWHVQR-GYVVLPKSVNPDRIKTNRKIFTLS
TEDFEAINNISKEKGEKRVVHPNWSPFEVFK
>Suva_8.173
--MSATL---------QYSTKTLPLNTGAKIPQVGLGTWQS-KDNDAYKSVVAALKDGYR
HIDTAAIYGNEDQVGQAIKDSGVPREEIFVTTKLWCTQHHEPAKALDQSLKRLGLDYVDL
YLMHWPVRLDPNYIKD-GH-----ILSIPTKEDGSRPVDITNWNFIKTWELMQELPKTNK
TRAVGVSNFSINNLKDLLASPGNQLTPAANQVELHPLLPQNELIDFCKSKGIMVEAYSPL
GSTDAPLLKEPVVLEIAKKNNVQPGHVVISWHAQR-GYVVLPKSVNPDRIKTNRKVFTLS
DEDFEAINNISKEKGEKRVVNPDWSPFEAFK
>Skud_15.283
--MPATL---------QDSTRTLSLNTGAQIPQVGLGTWQS-KDNDAYKSVLAALKDGYR
HIDTAAIYRNEDQVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDL
YLMHWPVRLDPDYIKD-GN-----ILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGK
AKAVGVSNFSINNLKDLLASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPL
GSTDAPLLKEPVILEIAKKNNVQPAHVVISWHAQR-GYVVLPKSVNPDRVKANRKIFTLS
DEDFEAINGISKAKGEKRVVHPNWSPFEAFK