MUSCLE (3.8) multiple sequence alignment

KLLA0E21099g       -------------------MQQQSNMVHLP----QTFLS-YPLYIGVEVALGVLTFNKFS
TBLA0G02010        ----------------MYKRITSSYSKVLP----NSFFILFPLYLGVELILGICILNKCS
AER256C            MTRTLHQRPEMRNIYSSLPTKSHSNMNHLP----KSFFG-LPLYIGVELSLGIAIFNKFC
Ecym_4762          -------------------------MVYLP----QSFFG-LPLYIGVELSLGVAIFNKFC
TBLA0A06520        --------------MTPERYRAAVKRFILP----KRFCGVAPLYLGVELVLGITIFNKCG
KLTH0F16082g       --------------------------------------------MGVEIGLGITILNKCS
Kwal_55.21432      --------------------------------------------MGVEIGLGITVLNKCS
ZYRO0F10010g       ----------------------MKTYLNLP----KRFLGFLPLYIGVEVALGVTILNKCS
SAKL0G02508g       --------------------MTKAEMVHLP----KSFLGFLPLYIGVELGLGISIFNKFS
TDEL0E01920        ------------------MATTRSKSMGLP----KSFLGFVPLYIGVEIALGISIINKCS
TPHA0E01770        ------------MVIGTSGRVRMQTPKLLP----KSFFGFLPLYIGVETVLGITIFNKCS
KNAG0C04920        ---------------------MTKLSSSLP----KTFFGIFPLYIGVEIVLGVTLLNKCS
Kpol_1062.30       ------------MNINQELSRVKTHYSNLP----RSFFGFLPLYIGVETVLGITILNKCS
NDAI0B05660        ------------------------------------------------------------
CAGL0A02794g       ---------------------MRLNKISFP----KSFFGFLPLYLGVEIVLGITILNKCS
NCAS0F03370        ---------------------MAHHSITLPKCF-QSFFGIIPLYLGVEIVLGITIFNKCS
KAFR0E03930        ---------------------MRTTSFSLP----KSFLGVLPLYLAVEIVLGITAFNKVS
Skud_4.636         ---------------------MRTSFLTLPKIFIKSFLGFMPLYLAVEIVLGISILNKCS
Smik_4.633         ---------------------MRSFLLTLP----KSFLGFMPLYLAVEIVLGISILNKCS
Suva_2.539         ---------------------MRSSLVALP----KSFLGFMPLYLAVEIVLGISILNKCS
YDR367W            ---------------------MRSSLLTLP----KSFLGFMPLYLAVEIVLGISILNKCS
                                                                               

KLLA0E21099g       GMYGVLALFTGHPLDFVQWTFYIWSIFCLVVFISGIRQVYKPNILLMSTVTFVFSVDTIV
TBLA0G02010        GFYGILALFTGHPLSIVQWLTYIWSIFTLLIYTQGMFHIKKPNVYLFSQIFTIFSLDTIF
AER256C            GLFGLLALFTGHPLDILQWLFYLWSFVTLLVYLHGLMQIYQPRLAAYCLVLVVYSTDTIL
Ecym_4762          GLYGILALFTGRPLDLIQWGFYVWSFAALLVFTKGLSQVYKPKLMTYCMVLTVYSLDTVL
TBLA0A06520        GAYGILALFNGHPLEFAQWVLYTWSIVCLAIYAQGLAKVHRPTLYTFSQVFIFFSVDTLL
KLTH0F16082g       GFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKLQTYAFVLLTFTADTLI
Kwal_55.21432      GFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSVLSYSLILLTFTTDTLV
ZYRO0F10010g       GLFGILALFTGHPLEFLQWVLYLWSIFSFVVYAQGLFTYSKPSLLVFSQIFIAFSIDTFL
SAKL0G02508g       GFYGILALFTGHPLDFMQWCFYSLSVLTLLVYLSGLWQIRKPNPLTYSLVLVVFTIDTLL
TDEL0E01920        GAYGILALFTGHPLDSMQWVLYIWSIFTLIICVQGLYQIHKPNVLTFSHIFITFIIDTLF
TPHA0E01770        GIYGILALFTGHPLTAIQWVSYLWSSFTLLIYAQGLFQVHHPNLLTYCQILITYSFDTIC
KNAG0C04920        GAFGILALFTGHPLDLMQWASYLWSVFTLVVYAQGLYQIHKPKLLTFSQIVVVFSIDTVL
Kpol_1062.30       GAYGILALFTGHPLNVFQWVSYLWSVFTLIIYSQGLFQVHTPSLLTYSQIFVVFSFDTFL
NDAI0B05660        ----------------MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQITVFFTLDTLF
CAGL0A02794g       GAYGILALFTGHPLDYMQWISYLWSVFTLIVFSQGLFMIHKPKLIVFSQILVYFTADTVL
NCAS0F03370        GAYGILALFTGHPLDFVQWVFYLWSIFTLIIFAQGLYEIHKPTLLTFSQILVFYSLDTIC
KAFR0E03930        GAFGILALFTGHPLAFMQWVFYLWSTVTLFVFAQGLFEIHKPNILTFSQIFVFYSIDTLC
Skud_4.636         GAYGILALFTGHPLDFMQWVAYLWSVFTLIVFSQGLYLIHKPNLLVFSQICILYTVDTIF
Smik_4.633         GVYGILALFTGHPLDFMQWVAYLWSVFTLIIFSQGLYLIHKPNLLLFSQICALYTLDTLF
Suva_2.539         GAYGILALFTGHPLDFMQWVAYLWSVFTLIVFAQGLYLIHKPNLLVFSQICVLYTVDTIC
YDR367W            GAYGILALFTGHPLDFMQWIAYLWSVFTLIVFSQGLYLIHKPNLLVFSQICVLYTIDTIS
                                    **  *  *   . :   *:     *     . :   :  **. 

KLLA0E21099g       SCIYCLWFTAVWFSQEGSTDVTDLKSAGTALGP------AHEGTTSTISTKVDTSKSASS
TBLA0G02010        TLFLTLYFALDWFSSDHSNKQS-----------------ENSLQRTEKDIELSQKQGASS
AER256C            TCLYTLWFTRGWFIDGDVGVTATAKEDDA----------DATQGSVTVENEPVSHQSASK
Ecym_4762          ACFFAVLFTGDWFSKEDTSSGSNPVSGKGIGVVDVG---KSGTQNFAYRRTVDDTQSAST
TBLA0A06520        TCAFTVYFTHEWFAANTT-------------------------------TRPPAAQGASD
KLTH0F16082g       TCFFTLWFSGMWFAAKESELSDPSSATQQTSGGI-----SSGSKLLTARGETLSSQSASQ
Kwal_55.21432      TCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNN----SPSGNLISKRGDTLSSQSASQ
ZYRO0F10010g       TCLFTLWFTNQWYTLEDN---------------------TPTQKSIAAAAMQEPNQGASQ
SAKL0G02508g       NCFFTIWFSAQWFSIEENDDNKGAVGTSKLQSAGRA---LGPAKELNRRNNSLASQSASQ
TDEL0E01920        TSFFTLWFTAQWYNLEGNSNNVKDTK-------------SSYSDAPVDYSSKIAHQGASE
TPHA0E01770        TCFFTIYFCSHWFTEES----------------------NAGDNINSSTTVDKYNQGASE
KNAG0C04920        TCLFTLWFTGVWFAEESNTDAAMGTA-------------ASAVARLVKRGAEIDTQGATE
Kpol_1062.30       TCVFTMIFSSQWFT-------------------------ETGSGMSDGSGVDEYGQGASE
NDAI0B05660        TCFFTLWFTAQWFQGSEGESA------------------VQTSTGVQKRDTSLASQGATA
CAGL0A02794g       TCFFTLWFSAQWFQSANEEKHETSA--------------PVGVSQNYRRSTDLASQGASE
NCAS0F03370        TCIFTLWFTSQWFQTEP----------------------TGTEEALQRRNESLESQGATE
KAFR0E03930        NCFFTLWFTGDWFNVESQTE-------------------AAVGSTITKRTEDISSQGASQ
Skud_4.636         TCFFTLWFTTQWFTLENPTDFGSIANSTADTALRTNGLSPIMAGKLTARSADKSGQSATE
Smik_4.633         TCFFTLWFTTQWFTLEDTAGGVASQSNNSN---------LISTERLTVRNTDISKQSATE
Suva_2.539         TCFFTLWFTTQWFTLEGNASIVADASSTATQTINYN---PIATGKLTARSTDTSGQGASE
YDR367W            TCFFTLWFTTQWFTLEDTANIDGNNALQSN---------PISTGKLTERGIDISKQSATE
                        : *   *:                                          :.*: 

KLLA0E21099g       GYEFFLIILLTLVPLAVRFYFNFIIIAFQQQLLRSGKFTFDQNDIEVNLHNRNILFKWRY
TBLA0G02010        TYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPKFIIDQDDVETDLKNKSFFKKFGG
AER256C            SYEYAFTMAFTLFALSLRFYSNFLIASFVQRMFQHNKFAAGCDDVEQDLKHKSVAYRAYA
Ecym_4762          HYEYSSTILLTLIVSALRFYSNFIIASFVRRMMKQNRYITEPDDVEYDLKNTSVAYRAYV
TBLA0A06520        AYEYSVSLLVTLASLVSRLYFNFIVGSFLQELFFRPAYTLDTDEVETELRHSSLLRRLWL
KLTH0F16082g       ATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYLVDQDDVDQDLKHKKLWQRWWI
Kwal_55.21432      GTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQDLKHRGFLRRWWI
ZYRO0F10010g       SFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYMVDYVDVEQELRTQPVWKRVWT
SAKL0G02508g       GYEYTMTMLFTVLTLAVRFYFNFILAAFVQQMLRHPKYIVDKDDVEQDLKNKSLFRRLCI
TDEL0E01920        GFEYGVTMFITILSLAGKLYFTFIIASFVQELLLHPRYMLDQDDVEQDLKHQSFWKRWWI
TPHA0E01770        SKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKYMIDQDDVEQDLKNKSIIVQWWI
KNAG0C04920        SYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHPQYLVDQDDIEQDLKNKFFLRRWWV
Kpol_1062.30       TYEYTFTILITVVALVSRMYFNFILAAFNQELFLHPKYMVDFDDVEQDLKNKNKIVQWWI
NDAI0B05660        GYEYFVTMLITFITLTFRFYFNCILASFVQELLSNPKFMIDQDDVEQDLKNKSMVKRWWI
CAGL0A02794g       RYEYTVTMLFTLVTLMFRMYFNFILASFVQELLRHPKYMVDQDDVEQDLKNKSAIKRWWI
NCAS0F03370        AYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHHPKYLVDQDDVEQDLKNKPVWKRWWI
KAFR0E03930        GYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKYMFDQDDIEQDLKNKSIWKRWWL
Skud_4.636         NYEYSITIFITLASLIFRFYFNLILGSFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWA
Smik_4.633         SYEYSITILITLVSLIFRFYFNLILASFVQELLHHPKYLVDRDDVEQNLKNKPIWKRLYA
Suva_2.539         SYEYSITILITLVSLIFRFYFNFILASFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWA
YDR367W            SYEYTMTILITLVSLIFRFYFNFILASFVQELLHHPKYLVDRDDVEQNLKNKPIWKRLWA
                     *    : .:.     . * . :: :* . ::    :     ::: :*.      .   

KLLA0E21099g       KFEKWCFYLCKRYL-
TBLA0G02010        ISKK----LFSHFF-
AER256C            KMQRWCYFLCRRYL-
Ecym_4762          STQRWCYYFCRRYL-
TBLA0A06520        QNQHYCYILSRRILS
KLTH0F16082g       RAENWSYRVCHHYLA
Kwal_55.21432      RAETHSYKICRRYLA
ZYRO0F10010g       RTQIRCLRYSKQLLT
SAKL0G02508g       KSEKWCYNACQRALA
TDEL0E01920        KSQKSCYKMSKSLLA
TPHA0E01770        KSKKRCYYTSKRFLA
KNAG0C04920        VSQKSSYSICRHVLV
Kpol_1062.30       KSKKSCYNLARHILT
NDAI0B05660        KNEKFCYRLCKSVLS
CAGL0A02794g       KSQKFCYKLCRHTLQ
NCAS0F03370        KNQKWSYKVCSHLLA
KAFR0E03930        KCQKSCYKLCKNLLA
Skud_4.636         KSQKSCYRLCKNLLE
Smik_4.633         KSQKGCYKLCKNLLN
Suva_2.539         KSQKGCYKLCKNLLE
YDR367W            KSQKGCYKLCKNLLE
                     :          : 

FASTA FORMAT for MUSCLE Version 3.6

>KLLA0E21099g
-------------------MQQQSNMVHLP----QTFLS-YPLYIGVEVALGVLTFNKFS
GMYGVLALFTGHPLDFVQWTFYIWSIFCLVVFISGIRQVYKPNILLMSTVTFVFSVDTIV
SCIYCLWFTAVWFSQEGSTDVTDLKSAGTALGP------AHEGTTSTISTKVDTSKSASS
GYEFFLIILLTLVPLAVRFYFNFIIIAFQQQLLRSGKFTFDQNDIEVNLHNRNILFKWRY
KFEKWCFYLCKRYL-
>TBLA0G02010
----------------MYKRITSSYSKVLP----NSFFILFPLYLGVELILGICILNKCS
GFYGILALFTGHPLSIVQWLTYIWSIFTLLIYTQGMFHIKKPNVYLFSQIFTIFSLDTIF
TLFLTLYFALDWFSSDHSNKQS-----------------ENSLQRTEKDIELSQKQGASS
TYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPKFIIDQDDVETDLKNKSFFKKFGG
ISKK----LFSHFF-
>AER256C
MTRTLHQRPEMRNIYSSLPTKSHSNMNHLP----KSFFG-LPLYIGVELSLGIAIFNKFC
GLFGLLALFTGHPLDILQWLFYLWSFVTLLVYLHGLMQIYQPRLAAYCLVLVVYSTDTIL
TCLYTLWFTRGWFIDGDVGVTATAKEDDA----------DATQGSVTVENEPVSHQSASK
SYEYAFTMAFTLFALSLRFYSNFLIASFVQRMFQHNKFAAGCDDVEQDLKHKSVAYRAYA
KMQRWCYFLCRRYL-
>Ecym_4762
-------------------------MVYLP----QSFFG-LPLYIGVELSLGVAIFNKFC
GLYGILALFTGRPLDLIQWGFYVWSFAALLVFTKGLSQVYKPKLMTYCMVLTVYSLDTVL
ACFFAVLFTGDWFSKEDTSSGSNPVSGKGIGVVDVG---KSGTQNFAYRRTVDDTQSAST
HYEYSSTILLTLIVSALRFYSNFIIASFVRRMMKQNRYITEPDDVEYDLKNTSVAYRAYV
STQRWCYYFCRRYL-
>TBLA0A06520
--------------MTPERYRAAVKRFILP----KRFCGVAPLYLGVELVLGITIFNKCG
GAYGILALFNGHPLEFAQWVLYTWSIVCLAIYAQGLAKVHRPTLYTFSQVFIFFSVDTLL
TCAFTVYFTHEWFAANTT-------------------------------TRPPAAQGASD
AYEYSVSLLVTLASLVSRLYFNFIVGSFLQELFFRPAYTLDTDEVETELRHSSLLRRLWL
QNQHYCYILSRRILS
>KLTH0F16082g
--------------------------------------------MGVEIGLGITILNKCS
GFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKLQTYAFVLLTFTADTLI
TCFFTLWFSGMWFAAKESELSDPSSATQQTSGGI-----SSGSKLLTARGETLSSQSASQ
ATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYLVDQDDVDQDLKHKKLWQRWWI
RAENWSYRVCHHYLA
>Kwal_55.21432
--------------------------------------------MGVEIGLGITVLNKCS
GFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSVLSYSLILLTFTTDTLV
TCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNN----SPSGNLISKRGDTLSSQSASQ
GTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQDLKHRGFLRRWWI
RAETHSYKICRRYLA
>ZYRO0F10010g
----------------------MKTYLNLP----KRFLGFLPLYIGVEVALGVTILNKCS
GLFGILALFTGHPLEFLQWVLYLWSIFSFVVYAQGLFTYSKPSLLVFSQIFIAFSIDTFL
TCLFTLWFTNQWYTLEDN---------------------TPTQKSIAAAAMQEPNQGASQ
SFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYMVDYVDVEQELRTQPVWKRVWT
RTQIRCLRYSKQLLT
>SAKL0G02508g
--------------------MTKAEMVHLP----KSFLGFLPLYIGVELGLGISIFNKFS
GFYGILALFTGHPLDFMQWCFYSLSVLTLLVYLSGLWQIRKPNPLTYSLVLVVFTIDTLL
NCFFTIWFSAQWFSIEENDDNKGAVGTSKLQSAGRA---LGPAKELNRRNNSLASQSASQ
GYEYTMTMLFTVLTLAVRFYFNFILAAFVQQMLRHPKYIVDKDDVEQDLKNKSLFRRLCI
KSEKWCYNACQRALA
>TDEL0E01920
------------------MATTRSKSMGLP----KSFLGFVPLYIGVEIALGISIINKCS
GAYGILALFTGHPLDSMQWVLYIWSIFTLIICVQGLYQIHKPNVLTFSHIFITFIIDTLF
TSFFTLWFTAQWYNLEGNSNNVKDTK-------------SSYSDAPVDYSSKIAHQGASE
GFEYGVTMFITILSLAGKLYFTFIIASFVQELLLHPRYMLDQDDVEQDLKHQSFWKRWWI
KSQKSCYKMSKSLLA
>TPHA0E01770
------------MVIGTSGRVRMQTPKLLP----KSFFGFLPLYIGVETVLGITIFNKCS
GIYGILALFTGHPLTAIQWVSYLWSSFTLLIYAQGLFQVHHPNLLTYCQILITYSFDTIC
TCFFTIYFCSHWFTEES----------------------NAGDNINSSTTVDKYNQGASE
SKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKYMIDQDDVEQDLKNKSIIVQWWI
KSKKRCYYTSKRFLA
>KNAG0C04920
---------------------MTKLSSSLP----KTFFGIFPLYIGVEIVLGVTLLNKCS
GAFGILALFTGHPLDLMQWASYLWSVFTLVVYAQGLYQIHKPKLLTFSQIVVVFSIDTVL
TCLFTLWFTGVWFAEESNTDAAMGTA-------------ASAVARLVKRGAEIDTQGATE
SYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHPQYLVDQDDIEQDLKNKFFLRRWWV
VSQKSSYSICRHVLV
>Kpol_1062.30
------------MNINQELSRVKTHYSNLP----RSFFGFLPLYIGVETVLGITILNKCS
GAYGILALFTGHPLNVFQWVSYLWSVFTLIIYSQGLFQVHTPSLLTYSQIFVVFSFDTFL
TCVFTMIFSSQWFT-------------------------ETGSGMSDGSGVDEYGQGASE
TYEYTFTILITVVALVSRMYFNFILAAFNQELFLHPKYMVDFDDVEQDLKNKNKIVQWWI
KSKKSCYNLARHILT
>NDAI0B05660
------------------------------------------------------------
----------------MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQITVFFTLDTLF
TCFFTLWFTAQWFQGSEGESA------------------VQTSTGVQKRDTSLASQGATA
GYEYFVTMLITFITLTFRFYFNCILASFVQELLSNPKFMIDQDDVEQDLKNKSMVKRWWI
KNEKFCYRLCKSVLS
>CAGL0A02794g
---------------------MRLNKISFP----KSFFGFLPLYLGVEIVLGITILNKCS
GAYGILALFTGHPLDYMQWISYLWSVFTLIVFSQGLFMIHKPKLIVFSQILVYFTADTVL
TCFFTLWFSAQWFQSANEEKHETSA--------------PVGVSQNYRRSTDLASQGASE
RYEYTVTMLFTLVTLMFRMYFNFILASFVQELLRHPKYMVDQDDVEQDLKNKSAIKRWWI
KSQKFCYKLCRHTLQ
>NCAS0F03370
---------------------MAHHSITLPKCF-QSFFGIIPLYLGVEIVLGITIFNKCS
GAYGILALFTGHPLDFVQWVFYLWSIFTLIIFAQGLYEIHKPTLLTFSQILVFYSLDTIC
TCIFTLWFTSQWFQTEP----------------------TGTEEALQRRNESLESQGATE
AYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHHPKYLVDQDDVEQDLKNKPVWKRWWI
KNQKWSYKVCSHLLA
>KAFR0E03930
---------------------MRTTSFSLP----KSFLGVLPLYLAVEIVLGITAFNKVS
GAFGILALFTGHPLAFMQWVFYLWSTVTLFVFAQGLFEIHKPNILTFSQIFVFYSIDTLC
NCFFTLWFTGDWFNVESQTE-------------------AAVGSTITKRTEDISSQGASQ
GYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKYMFDQDDIEQDLKNKSIWKRWWL
KCQKSCYKLCKNLLA
>Skud_4.636
---------------------MRTSFLTLPKIFIKSFLGFMPLYLAVEIVLGISILNKCS
GAYGILALFTGHPLDFMQWVAYLWSVFTLIVFSQGLYLIHKPNLLVFSQICILYTVDTIF
TCFFTLWFTTQWFTLENPTDFGSIANSTADTALRTNGLSPIMAGKLTARSADKSGQSATE
NYEYSITIFITLASLIFRFYFNLILGSFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWA
KSQKSCYRLCKNLLE
>Smik_4.633
---------------------MRSFLLTLP----KSFLGFMPLYLAVEIVLGISILNKCS
GVYGILALFTGHPLDFMQWVAYLWSVFTLIIFSQGLYLIHKPNLLLFSQICALYTLDTLF
TCFFTLWFTTQWFTLEDTAGGVASQSNNSN---------LISTERLTVRNTDISKQSATE
SYEYSITILITLVSLIFRFYFNLILASFVQELLHHPKYLVDRDDVEQNLKNKPIWKRLYA
KSQKGCYKLCKNLLN
>Suva_2.539
---------------------MRSSLVALP----KSFLGFMPLYLAVEIVLGISILNKCS
GAYGILALFTGHPLDFMQWVAYLWSVFTLIVFAQGLYLIHKPNLLVFSQICVLYTVDTIC
TCFFTLWFTTQWFTLEGNASIVADASSTATQTINYN---PIATGKLTARSTDTSGQGASE
SYEYSITILITLVSLIFRFYFNFILASFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWA
KSQKGCYKLCKNLLE
>YDR367W
---------------------MRSSLLTLP----KSFLGFMPLYLAVEIVLGISILNKCS
GAYGILALFTGHPLDFMQWIAYLWSVFTLIVFSQGLYLIHKPNLLVFSQICVLYTIDTIS
TCFFTLWFTTQWFTLEDTANIDGNNALQSN---------PISTGKLTERGIDISKQSATE
SYEYTMTILITLVSLIFRFYFNFILASFVQELLHHPKYLVDRDDVEQNLKNKPIWKRLWA
KSQKGCYKLCKNLLE