MUSCLE (3.8) multiple sequence alignment

TBLA0A06540        -----MSERKPKEDARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGR
Ecym_4790          MSDKREKRDPVTNDSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGR
KLLA0E21165g       MNSKGEKKEKITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGR
AER259W            MAKNNEGTGKDSIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGR
SAKL0G02442g       -MSGDKNLNPTTNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGR
KLTH0F16148g       MSKENETRQGGSSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGR
Kwal_55.21444      MSQEKHAGKEESSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGR
TDEL0E01950        ------MSEKRSKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGR
KNAG0C04940        ------MSDKMSSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSKKDLEVKKKAKVDKYGR
TPHA0H01780        ----MSSDKPVNTDERFSGVFNDPKFKNARKKNLKIKLDSRFSKSDLEVNRKARVDKYGR
ZYRO0F09944g       --MVEDRGSKGSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGR
Suva_2.538         --MAVDKLEKESVDARFAGIYNDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGR
Skud_4.635         --MAGDKSEKESIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGR
Smik_4.632         --MAEEKPQKEGADTRFAGIYSDPKFKNTRTKDHKIKLDSRFSKKDLEVQHKSKVDKYGR
YDR365C            --MAGENPKKEGVDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGR
Kpol_1016.8        --MSGEDSMKQSSDPRFSGIYSDPKFKNSKRKNIKIKLDDRFDKSDLQIKHKSKVDKYGR
CAGL0L11638g       ------MSEEKSNDPRFSRIYNDPKFKKSNSKQLKIKLDDRFGKKDLEVARRAKVDKYGR
KAFR0E03910        ----MSEGGKKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGR
NDAI0B05640        -MAPSNSENKESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGR
NCAS0F03350        --MSEDNSTKGTDDSRFSGIYNDPKFRKTKNKNLKIKLDERFSKKDLEIRRKAKVDKYGR
                                * **: :  ****.  .    *: **.**.* **:   .:.**.***

TBLA0A06540        KI---IDRNEKDKKDFDKYYTKDEDEENKDEEQDKSDQEEESEEEDVDEKADDDEDVLAE
Ecym_4790          RI---GSYDEKEAKDFDRYFSKNESVEK------------IQSDDEEGETED------IA
KLLA0E21165g       KI----VDANKDVKDFDRYFTKEKPEDK-----EDESNSSESSDDQEAEAA-------VH
AER259W            RI---GTAPGKEEKDFEKYFTKE---SS-----------ESAAEESDKED--------SS
SAKL0G02442g       RL---KDVDNKETKDFERYFEKE---EE-----------SSSPSDEEGES--------TK
KLTH0F16148g       RL---KGQESKDKRDFDKYYEKE---KSGKTAPDSELVGKPSEEDSEGGSSDEEGAASAK
Kwal_55.21444      SL---KGQENKDKKDFDKYYEKDDKKKEDKVKPDDE-EKSDSEAESANEAKDIGDSAAVK
TDEL0E01950        RM--RDVEDSKESKDFDKYFEQS---DE---------------EKKKDKD--------TE
KNAG0C04940        KI-KNGDANKKELEDFDKYFEKE---DE-------------AKESEDAEAPEA-----PV
TPHA0H01780        KI---SNLNNQEAKDFDKYFEKE--------------------EDGKGEEI-------AV
ZYRO0F09944g       RI----TGESKDLKDFDKYFEKEGKEGK-------EDESSSSSEDEEEE---------TE
Suva_2.538         KI--KDAHNTKELEDFDKYFEKE---AE---------------NEEDTEA--------DV
Skud_4.635         KI--KDARNNKELEDFDKYFEKE---AE---------------HDEDSEV--------AA
Smik_4.632         KI--KNTQNNKELEDFDKYFQKE---AE---------------NDEDTEA--------SV
YDR365C            KI--KNAQNNRELEDFDKYFEKE---AE---------------NDEDSEV--------NA
Kpol_1016.8        KL--KDVKDNKELEDFDKYFEKE---DE---------------EDKEEEIGTE-----AK
CAGL0L11638g       KI---KEGSSKDIEDFDKYFEKD---EK-------------SAEEESADEGDVA----KS
KAFR0E03910        KT--KDEGSKKELDDFEKYFEKE---DE--------------EEKKDTEET-------EE
NDAI0B05640        KL-ADSKGNEKEMNDFDKYFEKD---DEKKESEEIATEKSVSVEEKEDEEEERKETELED
NCAS0F03350        KIHEDNDMNNKELKDFDKYFEKE---GE-------------SADEKKEEEE-------IE
                             .:  **:.*: :.                     .               

TBLA0A06540        LARLDRARGDVPSDYVSSSDDYSSSESE-SSGESEVDSDEES---DAEI--ESAKPETGD
Ecym_4790          VSALDRARGEVPLDYESSSDENSSSESEEESEDSALDPDS-----ELEI--EESKPETGD
KLLA0E21165g       AKSVDRARGEPPADYVSSSDEESSSESEEESGDSDIESE------EIEL--EESKPASGN
AER259W            VAKLDRARGEVPADYVSSSDEESSSESEADSDDATAESDE-----EVEI--EEEKPESGD
SAKL0G02442g       VTSLDRARGEVPSDYLSSSEEESSSESEEESENSELESEES----DLEI--EESKPPTGD
KLTH0F16148g       TVSLDRARGEVHSDYVSSSDEESSSESEEDSADSDLESEES----EVQI--EEGEVKSGD
Kwal_55.21444      PVSLDRARGEVPSDYVSSSEDESSSESEAGSEDSDIESEES----EVEI--EDTKPQSGD
TDEL0E01950        ILTVDRARGEVPSDYVSSSDEFTSSDSE--VSDNEVESESES---EVEL--EKTEPSSGD
KNAG0C04940        KVVVDRARGEVPDDYVSSADEFTSSDSE-SSGSSESESESEQSDVEDEIEANSGKPESGD
TPHA0H01780        KPLIDRARGEVPSDYQSSLDDYTSSESE-DSEDEDLESEGES---EAEI--EETKPESGD
ZYRO0F09944g       SKVVDRARGELPEAYTSSESEDSESDLSEEESEADV---------AEAV--EEAKPESGD
Suva_2.538         KATVDRARGEVPNDYVSSGDEFTSSDSE-SSGESEIESEEES---EVEA--EDAKPESGD
Skud_4.635         KIVVDRARGEVPSDYVSSSDEFTSSDSE-SSGESEVESEVEG---EVET--EDVAAESGD
Smik_4.632         KTVVDRARGEISGDYVSSSDEFTSSDSE-SSEQSEVESEVES---EVEI--EDPKPECGD
YDR365C            KTVVDRARGEVPDDYVSSSDEFTSSDSE-SSGESEVESEEEN---EVEI--ENAKPESGD
Kpol_1016.8        VKVLDRARGEVPSDYESSSEEFTSSDSE-SSGESEVDSDEES---EDEV--ETSKPESGD
CAGL0L11638g       KKIVDRARGEVPSDYVSSEDEFTSSDSD-TSGDSDYDSEIES---GDEAQEEQTKVETGD
KAFR0E03910        KPKVDRARGEVPSDYVSSSDEYTSSESE-DSEEEELDSDVES---EVEI--ENTKPETGD
NDAI0B05640        DTNIDRARGDVPADYVSSSDEYTSSESE-ASDEEELDSDVES---GEEV--TTQEPESGE
NCAS0F03350        TVTVDRARGEVPADYVSSSDEYTSSESE-DSGESDLESEGES---EIEV--DEATPETGD
                      :*****:    * ** .: :.*: .    .                         *:

TBLA0A06540        PSKTVAVVNLDWDHVKSTDLMITFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPPKE
Ecym_4790          PTKVFAVVNLDWDHVRSVDLLATFNSFVPNGGSIKKVAIYPSEFGKERMKREEVEGPPRE
KLLA0E21165g       ATNTLAVVNLDWDHVKSADLFVTFKSFVPKGGEIQKIAIYPSEFGKERMQREEIEGPPKE
AER259W            PSKVLAVVNLDWDHVKCADLLVAFNSFVPEGGKIERVAIYPSEFGKERMQREEVEGPPRE
SAKL0G02442g       ATRMLAVVNLDWDHVKSTDLMVTFSSFVPKGGKILKIAIYPSEFGKERMQREEVEGPPRE
KLTH0F16148g       SSKTLAVVNLDWDHVKSTDLMVTFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPRE
Kwal_55.21444      SSKTLAVVNLDWDHVKSTDLMITFSSFVPSGGKIIKIAVYPSEFGKERLKREEMEGPPRE
TDEL0E01950        SSKTLAVVNLDWDNVRSSDLMITFSSFLPAGGRIEKIAIYPSEFGKERMQREEVEGPPKE
KNAG0C04940        PSKTLAVVNLDWDHVKSVDLMITFTGFIPKGGKIERICIYPSEFGKERLNREEKEGPPKE
TPHA0H01780        SSKTIAVVNLDWDHVKATDLLVTFSSFVPKGGKIERIAIFPSEFGKQRMEREELEGPPKE
ZYRO0F09944g       PSKTLAVVNLDWDHVRAADLMITFSSFLPSGGKIEKICIYPSEFGKERMQREEKEGPPRE
Suva_2.538         ASKTLAVVNLDWDHVKSEDLMITFSGFVPKGGKIERISVYPSEFGKERMQREEIEGPPKE
Skud_4.635         VSKTLAVVNLDWDHVKSEDLMITFSSFVPRGGKIERIAIFPSEFGRERMEREEVEGPPKE
Smik_4.632         VSKTLAVVNLDWDHVKSEDLMITFSSFVPKGGKLERVAIYPSEFGKERMQREEVEGPPKE
YDR365C            ISKNLAVVNLDWDHVKSEDLMITFSSFVPKGGKIERVAIYPSEFGKERMQREEVEGPPKE
Kpol_1016.8        SSKTLAVVNLDWDYVKSQDLMITFSSFLPKGGKIEKICIYPSEFGKERMAREEVEGPPRE
CAGL0L11638g       ATKTLAAVNLDWDHVRSVDMMVTFSSFLPKGGKIEKICIYPSEFGKERMKREEVEGPPRE
KAFR0E03910        ASKTLAVVNLDWDHVKSADLMVTFSSFVPKGGKISRICIYPSEFGKERLQREEVEGPPKE
NDAI0B05640        PSKTLAVVNLDWDHVKSSDLMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKE
NCAS0F03350        ATKTLAVVNLDWDHVRSSDLMITFSGFLPKGGKIEKIVVLPSEFGKERMQREETEGPPRE
                    :. .*.****** *.. *:: :*..*:* ** : .: : *****.:*: .*: ****.*

TBLA0A06540        LFKKKNKKGKKS------TAEDNEDDVSDVDINDLYEEGDADKNIDSKSLRQYQLERLRY
Ecym_4790          LFKRKQSK----------KEKDSDDENSDIDINDLYEVDDAEKDYDSKALRRYQLDRLRY
KLLA0E21165g       LFQSKKSK----------KNDKDDD---EINVESIYEEGDAE-DYDSKALRRYQLERLRY
AER259W            VFKSKK------------DKKAKQDDDDEIGLKDLYEQGDAEKDYDSKALRRYQLERLRY
SAKL0G02442g       LFQGKKK-----------KSQRKDGDDSDVDIKDLYEEGDAEKDYDSKALRRYQLDRLRY
KLTH0F16148g       IFKSKEKG----------KKSHGDDSDEELTVKDLYEEGDAD-DFDAKSLRRYQLERLRY
Kwal_55.21444      IFKSKNSK----------KKSHDDDSDSDVDVRDLYEEGDAE-DYDAKSLRRYQLDRLRY
TDEL0E01950        LFQKKKKKS---------KKGQQEDSDSDIDVKDLYEEGDADKNVDNKALRQYQLDRLRY
KNAG0C04940        LFHKKKSKKNSAAKSKGAESGKSDDDVSDVDIKDLYEEGDAEKDIDSKALRQYQLERLRY
TPHA0H01780        LFQKKKKKNSK-------KSNAEFNDDSDVDINDLYEEGDVDKEVDSKSLRQYQLDRLRY
ZYRO0F09944g       IFNKKKKH-------------HDEDSDSDVDIRDLYEEGDADKEVDNAALRQYQLERLRY
Suva_2.538         LFQRKKQVKASKK-----ENADDSDSDIDIGIKDLYEEGDADKDVDSRALRQYQLDRLRY
Skud_4.635         LFQKKNKNKHAKE-----KNSVGTDSDGDIGINDLYEEGDADKDVDSRALRQYQLDRLRY
Smik_4.632         LFQKKNKNKVSRK-----KKSDESDSDIDIGINDLYEEGDADKDVDSRALRQYQLDRLRY
YDR365C            LFQKKNKNKTSKK-----KKTDDSDSDMDIGIKDLYEEGDADKDVDSRALRQYQLDRLRY
Kpol_1016.8        LFNKKKNKKSSKKSSK--DDDEDDESDSDVDIRELYEEGDAEKDVDSKALRQYQLERLRY
CAGL0L11638g       LFQKNKKKKK--------KNSSEDEEESDVDIKDLYEEGNADDQVDKRALRQYQLDRLRY
KAFR0E03910        LFQKKNKKKA--------SHKEDFDSDSDVDIKDLYEEGDAEKDVDSKALRQYQLERLRY
NDAI0B05640        LFQKRKKKTSKSKKI---SDEANDSDVSDVDIKDLYEEGDADKDVDTKALRQYQLERLRY
NCAS0F03350        LFQKKKKKGKR-------ASVESDSDDSDVDIKDLYEEGDADKDVDTRALRQYQLERLRY
                   :*: .:                      :: : .:** .:.: : *  :**.***:****

TBLA0A06540        YYAVVYCNNIGTAESIYKNCDGTEYESTANVFDIRYVPDEMTFDDTPRDECDQLPKNYKP
Ecym_4790          YYAVVYCSDVLTAKAIYQNCDGTEFESTANMFDLRYVPDNMKFEDDPRDQCVSVPKDYKP
KLLA0E21165g       YYAVVYCSDIRTAESIYQNCDGTEYESTANVFDLRYVPDGMEMDDDPRDECTSLPKNYKP
AER259W            YYAVVYCNNVATAEAIYQNCDGTEYESTANMFDLRYVPEGVTFDDEPREECASVPKDYKP
SAKL0G02442g       YYAVVFCNNVETAEAIYQNCDGTEYESTANMFDLRYVPEGMDFSDEPKDECEDVPKNYKP
KLTH0F16148g       YYAVVYCNNKQTAESIYKNCDGTEYESTANMFDLRYVPDGMDFDDEARDECDSVPKNYRP
Kwal_55.21444      FYAVVYCNNVATAEAIYKNCDGTEFESTANMFDLRYVPDGMTFDDEARDECTSIPKNYQP
TDEL0E01950        YYAVVYCNNVAAAESIYNNCDGTEYESTANIFDIRYVPDGMDFDGKPKDSCTELPKNYKP
KNAG0C04940        FYAVVYCNNVETAKAIYDNCDATEYESTANMFDLRYVPEGMTFDDDPRDECEALPKNYKP
TPHA0H01780        YYAVVFCNNISTAEAIYNNCDGTEYESTANVFDLRYVPDGMDFEDQPYDECTELPKNYTP
ZYRO0F09944g       YYAIVYCNNVETGESIYSNCDGTEYESTANIFDLRYVPEGMEFDDEPKDECKELPKNYKP
Suva_2.538         YYAIVDCSDISTARAIYENCDGTEYESTANMFDLRYVPDGMTFDDTARDACSTLPKNYRP
Skud_4.635         YYAVVCCSDTTSAKAIYDNCDGTEYESTANMFDLRYVPDGMTFDDAARDECTSLPKNYRP
Smik_4.632         YYAIVYCSDITTSKAIYDNCDGTEYESTANMFDLRYVPDGMTFDDAVRDECTLLPKNYRP
YDR365C            YYAIVYCSDTTTSKAIYDNCDGTEYESTANMFDLRYVPDGMTFDDDVRDECSILPKNYRP
Kpol_1016.8        YYAVVYCNNIASAESIYENCDGTEYESSANIFDLRYVPDGTEFDDEPRDECLQLPKNYKV
CAGL0L11638g       YYAVIYCNNVESAKAIYENCDGTEYESTANIIDLRYVPDGMDFDDEPKDQCEELPKNYKP
KAFR0E03910        YYAVVYCNNIDTARAIYENCDGTEYESTANMFDLRYVPDGMTFDDEPRDECNSLPKNYKP
NDAI0B05640        YYAVVYCNNIETATAIYQNCDGTEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKP
NCAS0F03350        YYAVVYCNSVEAARAIYENCDGTEYESTANMFDLRYVPDGMDFDDEPRDQCSSLPKNYKP
                   :**:: *..  :. :**.***.**:**:**::*:****:   : .   : *  :**:*  

TBLA0A06540        LQFSTDALQHSNVKLTWDETPADRVEISKRAFSQKEIDEMDFKAYLASDSDESESE--LN
Ecym_4790          TQFSTSALQHSQVKLTWDETPADRVEISKRAFNQKEIEEMDFKAYLASDSDSSEGE--TN
KLLA0E21165g       AQFSTDALQHSKVKLTWDETPADRVEISKRAFTQKEIEEMDFKAYLASDSEESEVE--HD
AER259W            VQFSTSALQHLQVKLTWDETPADRVEMAKRAFSQKEIEDMDFKAYLASDSEESEAD--DN
SAKL0G02442g       AQFSTDALQHSNVKLTWDETPAERVEMSKRAFTQKEIEDMDFKAYLASDSEGSEEE--IN
KLTH0F16148g       SEFSTDALQHSKVKFTWDETPADRTAMAKRAFTQREIEDMDFKAYLASDSEDSEPE--NN
Kwal_55.21444      SQFSTDALQHSKVKLTWDETPADRVAMSKRAFTQKEIEDMDFKAYLASDSEESEPE--NN
TDEL0E01950        LQFSTDALQHSNVKLTWDETPADRLDVAKRAFTQKEIEDMDFKAYLASDSDDSEDE--VD
KNAG0C04940        LNFATDALQHSNVKLTWDETPADRVEIAKRAFSQKEIDDMDFKAYLASDSEDSDAK--VD
TPHA0H01780        LNFTTDALQHSNVKLTWDETPADRVEIAKRAFTQKEIDEMDFKAYLASDSEESEGE---N
ZYRO0F09944g       LEFSTDALQHSNVKLTWDETPTDRLEVSKRAFSQKELEDMDFQAYLASGTDESDGEENNN
Suva_2.538         HQFSTDALQHSNVKLTWDETPADRVEVAKRAFTQKEIDDMDFKAYLASDSDESDEE--VN
Skud_4.635         HQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMDFKAYLASDSDESDEQ--VD
Smik_4.632         HQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMDFKAYLASDSDESDEQ--ID
YDR365C            HQFSTDALQHSSVKLTWDETPADRVEVAKRAFTQKEIDDMDFKAYLASDSDESDGQ--VD
Kpol_1016.8        RQFTTDALQHSNVKLTWDETPADRVEIAKRAFTQKEIEEMDFKAYLASDSDESEEE--PN
CAGL0L11638g       HQFSTDALQHSNVKLTWDETPVDRVEVAKRAFTQKEIEDMDFKAYLASDSDESEEE--VN
KAFR0E03910        MQFSTDALQHSNVKLTWDETPADRVEVAKRAFSQKEIEDMDFKAYLASDSDESEEE--VN
NDAI0B05640        HQFSTDALQHSNVKLTWDETPVERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDE--LN
NCAS0F03350        HQFSTDALQHSNVKLTWDETPAERVEVAKRAFTQKEIEDMDFKAYLASDSDGSEDE--VN
                    :*:*.**** .**:******.:*  ::****.*.*:::***:*****.:: *: .   :

TBLA0A06540        NDSKNKLKSLVGGGAFGNVFGKDTEYDLDGSD----DEDGVDMEITFTPGLDEK--KEAS
Ecym_4790          EKTKNALRSLVNDSI---QVAHKSVFDKHG------SEEEADVEITFTPGLE----NGDA
KLLA0E21165g       DQVKNKLKALVMDSV---KVGQKSLFDQKEDE----DDNEADMEITFTPGLDE---SGQQ
AER259W            SEAKNKLRSLVS-SV---KVADKPLFADES------DEEEADVQITFTPGLE----GGEA
SAKL0G02442g       EDSRNKLKSLVSESI---RIGDKSLFDKSDN-----EGGDVDMEITFTPGLD----EAKK
KLTH0F16148g       QELKNKLKSLVNQSV---QVGEKSIFDQDPKD----GESDVDMQITFAPALAEG-GSGDA
Kwal_55.21444      QDLKTKLKSLVSQSV---KVGDKSIFDQAPEE----GESDVDMQITFAPGLAE---GAED
TDEL0E01950        AQSKSKLKSLVTGSS---AFD----FTRKNADEVDGNDEEVDMEITFTPGLDE---ANKD
KNAG0C04940        ETMKNRLKALVGGTL---KASRPKGGAEEDED----DEEGMDMEITFTPGLDEA--QVAE
TPHA0H01780        EEVKNKLKSLVGLSM---KIGDKSIMDNKSDN----EDGEVDMEITFTPGLAE---NDNN
ZYRO0F09944g       EEAKNKLKSLVGQSL---------AYGKQ-------QEEEPDMEITFTPGLD----DSKP
Suva_2.538         EDAKSKLKSLVGGLG----FNSKKENANDG------DEEEVDMEITFTPALE----GGDE
Skud_4.635         EDAKNKLKSLVGGLD----FNMKKKGANDGK-----EEGEVDMEITFTPALE----GENE
Smik_4.632         EDAKNKLKSLVGGIN----FNSKKENVKD-------SDEEVDMEITFTPALE----GGNE
YDR365C            EEAKNKLKSLVGDFG----FNSKKETPND-------EDEEVDMEITFTPALE----GGNE
Kpol_1016.8        DDVKNKLKSLVSQST---TIGDKSIFDDKGDNN---EEDDVDMEITFTPGLGEG--GEDG
CAGL0L11638g       EEAKNKLKSLVGESL--------KIDGKDGSD----EDEGMDMEITFTPGLDEANAEGED
KAFR0E03910        ENSKNKLKALVGESL---DFGTNGASD---------GESEVDMEITFTPGLD-----EAK
NDAI0B05640        EDAKNKLKALVGGGG----FGSREIFGGKGAKAGE-DEDEVDMEITFNPALD----ENSP
NCAS0F03350        QDAKNKLKSLVGDSL---RIGNQPIFGSKDTLEG--EDEEVDMEITFDPGLS----EGVE
                      .. *.:**                              *::*** *.*         

TBLA0A06540        DNETKKEESTIEKLQRKEKERRKLRKQKVKDLKEKSVQERKEKLNSNRNRNKKNNNELLK
Ecym_4790          PKEENEEETALDKIKRKEKERRKKRKERVKELKMQAIDEKKARRRKGDDG-AVTEAEKEL
KLLA0E21165g       DTNDNEEESTIDKIRRKEKERRKKRKDRVKELKKESEAKLKENLKKKKDT-SHSIDD---
AER259W            KEEDAEEENILEKLKRKEKERRKKRKERVKELKKQAEEEKKSSKKEKHAS-KSESEQKSE
SAKL0G02442g       DDEDGKDETTIEKIRRKEKERRKMRKERVKELKKKAEEKKREKLNKSDSQ-SKTADEVEK
KLTH0F16148g       DDGEKTEETTLEKVRRKEKERKKMRKERIKELKKQAEDDKKQKLKEARRK-PEPSATD--
Kwal_55.21444      DKQENAEETTLEKLKRKEKERKKMRKERIKELKKQAEEEKKQKRKESRYK-PESTVED--
TDEL0E01950        GQEGQEEESTIDKVRRKEKERRKARKAKVKELKHQAEQDKKVKLKKGRGK-QTSDIEQD-
KNAG0C04940        QEAAAEEESTIDKIRRKEKERRKNRKQKLKELKKNAEKEKRDKLKSLKKG-RKNGEEEPV
TPHA0H01780        DKEEENEETTIEKVRRKEKERRKARKQKLKEIKQNSEQEKREKLKSLKTE-RSKKSEDTE
ZYRO0F09944g       QADEDHEETTIEKVKRKEQERRKARKQRLKELKQQAEQEKKEKLRSGKNK-KQVEDESD-
Suva_2.538         KPIEGQEETSIEKIRRKEKERRKARKQKVKELKQQSEKEKRGKFKSANKK-HVADEEEIK
Skud_4.635         KPIEGQDETTIEKIRRKEKERRKARKQKVKELKQQSEKDKKSKLKSVNKK-HVADEEEIK
Smik_4.632         QPSEEQEETTIEKIRRKEKERRKARKQKVKELKQQSEKDKKTKLKSINKK-YAEGEEDIK
YDR365C            KSSEDKEETTIEKIRRKEKERRKARKQKVKELKQQSEKDKKSKLKSVNKK-HTNDEEEIE
Kpol_1016.8        DEDKDNEETTIEKVRRKEKERRKARKDKLKQLKQQSENEKKEKLKELKKE-RNGNGKNTN
CAGL0L11638g       KDGEDNEETTIEKVRRKEKERRKARKQKLKELKQKSEEEKKQKLKSKHDE-PLS------
KAFR0E03910        ESEEEKEESTIEKVRRKEKERRKARKDKLKQLKKDAENEKKEKMRSLHDK-KSRKAETEN
NDAI0B05640        KEDGEHEETTIEKVARKEKERRKARKQKLKELKTKAQQEKKDKLKLSKNKKNHTKEDDAE
NCAS0F03350        KTE-EHEETTIEKVARKEKERRKARKQKLKELKNNAQKEKKDKLKSLKGK-KHNDSTEGD
                         :*. ::*: ***:**.* ** .:*::* .:  . .   .               

TBLA0A06540        DEKEKQDKSKAELELLM-MDED--DRISGVNNKAHFNMNEILRSEKEKGKKSKYQDKNKI
Ecym_4790          R-----KKKQAELELLM-LEDET-GKKSTLNNNAHFNMNEIIKSQKEKTKKSRYQNKNVI
KLLA0E21165g       ------DKKKGELELLM-LDEN--EGESTINNKAHFNMNEILKSEKEKSKKAKYQNKEKI
AER259W            ------NDKRAELELLM-MEDD--ENSQSINSSAHFNMNDILRSEKERGKKSKYQKKDKI
SAKL0G02442g       E-----KKSKAELELLM-MDDDN-DTESKLNKKAHFNMTEILRSEKEKGKRTKYQNREKI
KLTH0F16148g       ------SKSQAELELLM-MDDSE-EANSKLNKKAHFNMNEIVRSEKEKGKKAKFQDKNRI
Kwal_55.21444      ------AKSKAELELLM-MDDDENNSSSKLNKKAHFNMNEIVRSEKEKGKKSRYQNKDKI
TDEL0E01950        ------PKSKAELELLM-MDDED-DTEKSINKKAHFNMKEILKSEKEKKKKNKYQDKNKI
KNAG0C04940        D-----DKAKAELELLMMDEDEERDSKSTLNKKMHFNMNEIMRSEKEKKKKSKFQDKNRI
TPHA0H01780        SD----KNAKAELELLM-MDEDEINGTSTINKKAHFNMKEILRSEKEKTKKSKFQNKEKI
ZYRO0F09944g       ------AKSKAELELLM-MEDED-DTEKSLNKKAHFNMNEILKSEKEKKKKGKYQDKGKI
Suva_2.538         NN----AKSKAELELLM-DDDGDAEAESSINSKAHFNMNEILRSEKEKHKKSRYQKKERI
Skud_4.635         NN----AKSKAELELLM-DEDDA-ETEGSMNSKAHFSMKEILRSEKEKHKRGRYQKKERI
Smik_4.632         NN----AKAKAELELLM-DDDDA-EAQGTINNKAHFNMNEILRSEKEKNKKSRYQNKERI
YDR365C            KN----AKSKAELELLM-DDDDDTETQGTINNKAHFNMNEILRSEKEKHKKGRYQKKERI
Kpol_1016.8        VD----AKAKAELELLM-MDDET-ESTSTLNKKAHFNMNEIVRSEKEKGKKSKYQDKNKI
CAGL0L11638g       ------DKKKAELELLM-MDEN--ESNSGINSKAHFNMNEILRSEKEKSKKGKFQKKQRI
KAFR0E03910        EEA---AKAKAELELLM-IEDED-DTEQSLNKKAHFNLNEIIRSEKEKGKKGKYQRKEKI
NDAI0B05640        AKKN--QKSRAELELLM-MDDDE-ETGSTINNKAHFNMNEILRSEKEKGKRGKYQNKDKI
NCAS0F03350        AST---AKSKAELELLM-MDDED-DTETGINKKAHFNMKEILRSEKEKSKKGKYQDKRRI
                          . ..******  ::        :*.. **.:.:*:.*:**. *. .:* .  *

TBLA0A06540        VQDEFKPNLNDSRFDEIFEDHAFAIDPTQPEFKQTSAMKEILNERTKRA---SKKQNKDK
Ecym_4790          VDDNFKPDLNDPRFKEVFEDHDFAIDPSQPEFKKTPAMKEILEERTRRSS--KMKKAFNK
KLLA0E21165g       VDDEFTPDVNDPRFKEVFEDHDFAIDPTQPEFKKTPAMEKILKERTVRSS--KKSRGKKR
AER259W            VEDDFKPDLNDPRFKEVFEDRDFAIDPSQPEFKETAAMKQILQERRKRS---SKSASKKR
SAKL0G02442g       VEDEFKPDLNDPRFREVFEDHDFAIDPSQPEFKGTTAMKEILKERNQRV---SKKKGNKK
KLTH0F16148g       VEDEFKPDLNDPRFSEVFEDHDFAIDPSQPEFKGTAAMKQILQERNKRS---QKGKNKKR
Kwal_55.21444      VEDEFKPDLNDPRFAEVFEDRDFAIDPSQPEFKGTAAMKQILQERTKRS---HKGQNKKR
TDEL0E01950        VVDDFKPDLEDPRFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNKRSKQA-----HRVNSK
KNAG0C04940        VEDEFKPDLSDDRFKEVFEDHDFAIDPSRPEFKETPAMQKILQERSNR----ARSKGKKR
TPHA0H01780        VEDNFKADLNDPRFNEMFEDHDFAIDPTQSEYKETAAMKEILKERSKRS---TMKKANRS
ZYRO0F09944g       MEDEFKPDLNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEILEERSKRA---HKKRKPLA
Suva_2.538         VEDNFTPDLEDPRFKEVFEDHDFAIDPTQPEYKGTQAMNKILKERGKRVH--DRKRKHGK
Skud_4.635         VEDTFAPDLEDPRFKEVFEDHDFAIDPTQPEYKNTQAMSTILKERGKRVK--DKKRKHSD
Smik_4.632         VEDNFTPDLNDPRFKEVFEDHDFAIDPTQPEYKSTQAMNKILKERGKRVK--DKKRKHDG
YDR365C            VEDTFTPDLEDPRFKEVFEDHDFAIDPTQPEFKGTQAMSKILKERSKRVK--NKKRKLGG
Kpol_1016.8        VEDDFKPDLNDPRFKEIFEDHDFAIDPTQSEFKETTAMKEILKERSRRS---NKNKSNNK
CAGL0L11638g       VEDDFKPNLDDDRFKEVFEDHDFAIDPSQPEFKETKAMKEILKERRKR----SRDSKHGK
KAFR0E03910        VEDDFKPDLSDPRFKEVFEDHDFAIDPSQPEFKQTNAMKQILNERSKRSKERSKGGKNKK
NDAI0B05640        VEDEFKPDLNDPRFKEVFEDHDFAIDPSRPEFKETKAMKEILKERSKRI---HKKGSNKK
NCAS0F03350        VEDNFKPDLNDPRFKEVFEDHDFAIDPSRPEFKETPAMKEILKERSKRS---SKNAQKKK
                   : * * .::.* ** *:**.. *****:..*:. * **. :*::*  .            

TBLA0A06540        DNKK-RKNTNEDKSDISNIVNKLKKKIKNKRNNF-------
Ecym_4790          RKASYDHPQSGQTDSLNSLVEKFKKKHKKVHKK--------
KLLA0E21165g       NHEIANTEHSKDINKIGGLVEKLKAKNKRTKH---------
AER259W            KTDEQSDSAMDSAGDLKGLVAKLKRKGKKPKL---------
SAKL0G02442g       RKLE-QPRKNNNSNELNGLVAKLKRRNKKSRK---------
KLTH0F16148g       EANG-DIAEPSGNNDLKGLVNKLKHSSKNKRQRR-------
Kwal_55.21444      KADG-NLANQNGQSDLKGLVKKLKHSSKAKK----------
TDEL0E01950        RKIATQENDTNENGDIANIVAKLKKGGRKKVKSK-------
KNAG0C04940        KSAE-QSTDTSDKTDISQIVSKLKRKKKSKTKA--------
TPHA0H01780        EKRK-ISPSDGSQKDISNIVNKLKNKNKKSKR---------
ZYRO0F09944g       DDGD----SKDNKHDISNIVNKLKKKGNNKKAKR-------
Suva_2.538         NEND-VTEDGNDNKNIGNLVNKLKKKSKSSKKIKV------
Skud_4.635         NGND-VAKNGDSKKNIGNLVNKLKKKNKSSKKVKV------
Smik_4.632         SEND-IIKNGDSKGNIGNLVKKLKKKSKSSKKMAV------
YDR365C            SENN-MTNNADDNEDIGNLVNKLKKKSKSSKKVKV------
Kpol_1016.8        RKHL-SSNDNNQKKNISNLVDKIKRKEKKMKHK--------
CAGL0L11638g       EEHT-------DKNDINKIVSKLKSKKHKK-----------
KAFR0E03910        RKLD-TSTSKNGKNAISNIVNKLKKNGKQNNRTSV------
NDAI0B05640        RRLSITENAGAESSDITNIVNKLKTKSTSKSKKSKKSEYLK
NCAS0F03350        RSHSLMDNQANETSDISNIVSKLKKKGGKGPKKSRYNN---
                                  :  :* *:*                 

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0A06540
-----MSERKPKEDARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGR
KI---IDRNEKDKKDFDKYYTKDEDEENKDEEQDKSDQEEESEEEDVDEKADDDEDVLAE
LARLDRARGDVPSDYVSSSDDYSSSESE-SSGESEVDSDEES---DAEI--ESAKPETGD
PSKTVAVVNLDWDHVKSTDLMITFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPPKE
LFKKKNKKGKKS------TAEDNEDDVSDVDINDLYEEGDADKNIDSKSLRQYQLERLRY
YYAVVYCNNIGTAESIYKNCDGTEYESTANVFDIRYVPDEMTFDDTPRDECDQLPKNYKP
LQFSTDALQHSNVKLTWDETPADRVEISKRAFSQKEIDEMDFKAYLASDSDESESE--LN
NDSKNKLKSLVGGGAFGNVFGKDTEYDLDGSD----DEDGVDMEITFTPGLDEK--KEAS
DNETKKEESTIEKLQRKEKERRKLRKQKVKDLKEKSVQERKEKLNSNRNRNKKNNNELLK
DEKEKQDKSKAELELLM-MDED--DRISGVNNKAHFNMNEILRSEKEKGKKSKYQDKNKI
VQDEFKPNLNDSRFDEIFEDHAFAIDPTQPEFKQTSAMKEILNERTKRA---SKKQNKDK
DNKK-RKNTNEDKSDISNIVNKLKKKIKNKRNNF-------
>Ecym_4790
MSDKREKRDPVTNDSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGR
RI---GSYDEKEAKDFDRYFSKNESVEK------------IQSDDEEGETED------IA
VSALDRARGEVPLDYESSSDENSSSESEEESEDSALDPDS-----ELEI--EESKPETGD
PTKVFAVVNLDWDHVRSVDLLATFNSFVPNGGSIKKVAIYPSEFGKERMKREEVEGPPRE
LFKRKQSK----------KEKDSDDENSDIDINDLYEVDDAEKDYDSKALRRYQLDRLRY
YYAVVYCSDVLTAKAIYQNCDGTEFESTANMFDLRYVPDNMKFEDDPRDQCVSVPKDYKP
TQFSTSALQHSQVKLTWDETPADRVEISKRAFNQKEIEEMDFKAYLASDSDSSEGE--TN
EKTKNALRSLVNDSI---QVAHKSVFDKHG------SEEEADVEITFTPGLE----NGDA
PKEENEEETALDKIKRKEKERRKKRKERVKELKMQAIDEKKARRRKGDDG-AVTEAEKEL
R-----KKKQAELELLM-LEDET-GKKSTLNNNAHFNMNEIIKSQKEKTKKSRYQNKNVI
VDDNFKPDLNDPRFKEVFEDHDFAIDPSQPEFKKTPAMKEILEERTRRSS--KMKKAFNK
RKASYDHPQSGQTDSLNSLVEKFKKKHKKVHKK--------
>KLLA0E21165g
MNSKGEKKEKITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGR
KI----VDANKDVKDFDRYFTKEKPEDK-----EDESNSSESSDDQEAEAA-------VH
AKSVDRARGEPPADYVSSSDEESSSESEEESGDSDIESE------EIEL--EESKPASGN
ATNTLAVVNLDWDHVKSADLFVTFKSFVPKGGEIQKIAIYPSEFGKERMQREEIEGPPKE
LFQSKKSK----------KNDKDDD---EINVESIYEEGDAE-DYDSKALRRYQLERLRY
YYAVVYCSDIRTAESIYQNCDGTEYESTANVFDLRYVPDGMEMDDDPRDECTSLPKNYKP
AQFSTDALQHSKVKLTWDETPADRVEISKRAFTQKEIEEMDFKAYLASDSEESEVE--HD
DQVKNKLKALVMDSV---KVGQKSLFDQKEDE----DDNEADMEITFTPGLDE---SGQQ
DTNDNEEESTIDKIRRKEKERRKKRKDRVKELKKESEAKLKENLKKKKDT-SHSIDD---
------DKKKGELELLM-LDEN--EGESTINNKAHFNMNEILKSEKEKSKKAKYQNKEKI
VDDEFTPDVNDPRFKEVFEDHDFAIDPTQPEFKKTPAMEKILKERTVRSS--KKSRGKKR
NHEIANTEHSKDINKIGGLVEKLKAKNKRTKH---------
>AER259W
MAKNNEGTGKDSIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGR
RI---GTAPGKEEKDFEKYFTKE---SS-----------ESAAEESDKED--------SS
VAKLDRARGEVPADYVSSSDEESSSESEADSDDATAESDE-----EVEI--EEEKPESGD
PSKVLAVVNLDWDHVKCADLLVAFNSFVPEGGKIERVAIYPSEFGKERMQREEVEGPPRE
VFKSKK------------DKKAKQDDDDEIGLKDLYEQGDAEKDYDSKALRRYQLERLRY
YYAVVYCNNVATAEAIYQNCDGTEYESTANMFDLRYVPEGVTFDDEPREECASVPKDYKP
VQFSTSALQHLQVKLTWDETPADRVEMAKRAFSQKEIEDMDFKAYLASDSEESEAD--DN
SEAKNKLRSLVS-SV---KVADKPLFADES------DEEEADVQITFTPGLE----GGEA
KEEDAEEENILEKLKRKEKERRKKRKERVKELKKQAEEEKKSSKKEKHAS-KSESEQKSE
------NDKRAELELLM-MEDD--ENSQSINSSAHFNMNDILRSEKERGKKSKYQKKDKI
VEDDFKPDLNDPRFKEVFEDRDFAIDPSQPEFKETAAMKQILQERRKRS---SKSASKKR
KTDEQSDSAMDSAGDLKGLVAKLKRKGKKPKL---------
>SAKL0G02442g
-MSGDKNLNPTTNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGR
RL---KDVDNKETKDFERYFEKE---EE-----------SSSPSDEEGES--------TK
VTSLDRARGEVPSDYLSSSEEESSSESEEESENSELESEES----DLEI--EESKPPTGD
ATRMLAVVNLDWDHVKSTDLMVTFSSFVPKGGKILKIAIYPSEFGKERMQREEVEGPPRE
LFQGKKK-----------KSQRKDGDDSDVDIKDLYEEGDAEKDYDSKALRRYQLDRLRY
YYAVVFCNNVETAEAIYQNCDGTEYESTANMFDLRYVPEGMDFSDEPKDECEDVPKNYKP
AQFSTDALQHSNVKLTWDETPAERVEMSKRAFTQKEIEDMDFKAYLASDSEGSEEE--IN
EDSRNKLKSLVSESI---RIGDKSLFDKSDN-----EGGDVDMEITFTPGLD----EAKK
DDEDGKDETTIEKIRRKEKERRKMRKERVKELKKKAEEKKREKLNKSDSQ-SKTADEVEK
E-----KKSKAELELLM-MDDDN-DTESKLNKKAHFNMTEILRSEKEKGKRTKYQNREKI
VEDEFKPDLNDPRFREVFEDHDFAIDPSQPEFKGTTAMKEILKERNQRV---SKKKGNKK
RKLE-QPRKNNNSNELNGLVAKLKRRNKKSRK---------
>KLTH0F16148g
MSKENETRQGGSSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGR
RL---KGQESKDKRDFDKYYEKE---KSGKTAPDSELVGKPSEEDSEGGSSDEEGAASAK
TVSLDRARGEVHSDYVSSSDEESSSESEEDSADSDLESEES----EVQI--EEGEVKSGD
SSKTLAVVNLDWDHVKSTDLMVTFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPRE
IFKSKEKG----------KKSHGDDSDEELTVKDLYEEGDAD-DFDAKSLRRYQLERLRY
YYAVVYCNNKQTAESIYKNCDGTEYESTANMFDLRYVPDGMDFDDEARDECDSVPKNYRP
SEFSTDALQHSKVKFTWDETPADRTAMAKRAFTQREIEDMDFKAYLASDSEDSEPE--NN
QELKNKLKSLVNQSV---QVGEKSIFDQDPKD----GESDVDMQITFAPALAEG-GSGDA
DDGEKTEETTLEKVRRKEKERKKMRKERIKELKKQAEDDKKQKLKEARRK-PEPSATD--
------SKSQAELELLM-MDDSE-EANSKLNKKAHFNMNEIVRSEKEKGKKAKFQDKNRI
VEDEFKPDLNDPRFSEVFEDHDFAIDPSQPEFKGTAAMKQILQERNKRS---QKGKNKKR
EANG-DIAEPSGNNDLKGLVNKLKHSSKNKRQRR-------
>Kwal_55.21444
MSQEKHAGKEESSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGR
SL---KGQENKDKKDFDKYYEKDDKKKEDKVKPDDE-EKSDSEAESANEAKDIGDSAAVK
PVSLDRARGEVPSDYVSSSEDESSSESEAGSEDSDIESEES----EVEI--EDTKPQSGD
SSKTLAVVNLDWDHVKSTDLMITFSSFVPSGGKIIKIAVYPSEFGKERLKREEMEGPPRE
IFKSKNSK----------KKSHDDDSDSDVDVRDLYEEGDAE-DYDAKSLRRYQLDRLRY
FYAVVYCNNVATAEAIYKNCDGTEFESTANMFDLRYVPDGMTFDDEARDECTSIPKNYQP
SQFSTDALQHSKVKLTWDETPADRVAMSKRAFTQKEIEDMDFKAYLASDSEESEPE--NN
QDLKTKLKSLVSQSV---KVGDKSIFDQAPEE----GESDVDMQITFAPGLAE---GAED
DKQENAEETTLEKLKRKEKERKKMRKERIKELKKQAEEEKKQKRKESRYK-PESTVED--
------AKSKAELELLM-MDDDENNSSSKLNKKAHFNMNEIVRSEKEKGKKSRYQNKDKI
VEDEFKPDLNDPRFAEVFEDRDFAIDPSQPEFKGTAAMKQILQERTKRS---HKGQNKKR
KADG-NLANQNGQSDLKGLVKKLKHSSKAKK----------
>TDEL0E01950
------MSEKRSKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGR
RM--RDVEDSKESKDFDKYFEQS---DE---------------EKKKDKD--------TE
ILTVDRARGEVPSDYVSSSDEFTSSDSE--VSDNEVESESES---EVEL--EKTEPSSGD
SSKTLAVVNLDWDNVRSSDLMITFSSFLPAGGRIEKIAIYPSEFGKERMQREEVEGPPKE
LFQKKKKKS---------KKGQQEDSDSDIDVKDLYEEGDADKNVDNKALRQYQLDRLRY
YYAVVYCNNVAAAESIYNNCDGTEYESTANIFDIRYVPDGMDFDGKPKDSCTELPKNYKP
LQFSTDALQHSNVKLTWDETPADRLDVAKRAFTQKEIEDMDFKAYLASDSDDSEDE--VD
AQSKSKLKSLVTGSS---AFD----FTRKNADEVDGNDEEVDMEITFTPGLDE---ANKD
GQEGQEEESTIDKVRRKEKERRKARKAKVKELKHQAEQDKKVKLKKGRGK-QTSDIEQD-
------PKSKAELELLM-MDDED-DTEKSINKKAHFNMKEILKSEKEKKKKNKYQDKNKI
VVDDFKPDLEDPRFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNKRSKQA-----HRVNSK
RKIATQENDTNENGDIANIVAKLKKGGRKKVKSK-------
>KNAG0C04940
------MSDKMSSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSKKDLEVKKKAKVDKYGR
KI-KNGDANKKELEDFDKYFEKE---DE-------------AKESEDAEAPEA-----PV
KVVVDRARGEVPDDYVSSADEFTSSDSE-SSGSSESESESEQSDVEDEIEANSGKPESGD
PSKTLAVVNLDWDHVKSVDLMITFTGFIPKGGKIERICIYPSEFGKERLNREEKEGPPKE
LFHKKKSKKNSAAKSKGAESGKSDDDVSDVDIKDLYEEGDAEKDIDSKALRQYQLERLRY
FYAVVYCNNVETAKAIYDNCDATEYESTANMFDLRYVPEGMTFDDDPRDECEALPKNYKP
LNFATDALQHSNVKLTWDETPADRVEIAKRAFSQKEIDDMDFKAYLASDSEDSDAK--VD
ETMKNRLKALVGGTL---KASRPKGGAEEDED----DEEGMDMEITFTPGLDEA--QVAE
QEAAAEEESTIDKIRRKEKERRKNRKQKLKELKKNAEKEKRDKLKSLKKG-RKNGEEEPV
D-----DKAKAELELLMMDEDEERDSKSTLNKKMHFNMNEIMRSEKEKKKKSKFQDKNRI
VEDEFKPDLSDDRFKEVFEDHDFAIDPSRPEFKETPAMQKILQERSNR----ARSKGKKR
KSAE-QSTDTSDKTDISQIVSKLKRKKKSKTKA--------
>TPHA0H01780
----MSSDKPVNTDERFSGVFNDPKFKNARKKNLKIKLDSRFSKSDLEVNRKARVDKYGR
KI---SNLNNQEAKDFDKYFEKE--------------------EDGKGEEI-------AV
KPLIDRARGEVPSDYQSSLDDYTSSESE-DSEDEDLESEGES---EAEI--EETKPESGD
SSKTIAVVNLDWDHVKATDLLVTFSSFVPKGGKIERIAIFPSEFGKQRMEREELEGPPKE
LFQKKKKKNSK-------KSNAEFNDDSDVDINDLYEEGDVDKEVDSKSLRQYQLDRLRY
YYAVVFCNNISTAEAIYNNCDGTEYESTANVFDLRYVPDGMDFEDQPYDECTELPKNYTP
LNFTTDALQHSNVKLTWDETPADRVEIAKRAFTQKEIDEMDFKAYLASDSEESEGE---N
EEVKNKLKSLVGLSM---KIGDKSIMDNKSDN----EDGEVDMEITFTPGLAE---NDNN
DKEEENEETTIEKVRRKEKERRKARKQKLKEIKQNSEQEKREKLKSLKTE-RSKKSEDTE
SD----KNAKAELELLM-MDEDEINGTSTINKKAHFNMKEILRSEKEKTKKSKFQNKEKI
VEDNFKADLNDPRFNEMFEDHDFAIDPTQSEYKETAAMKEILKERSKRS---TMKKANRS
EKRK-ISPSDGSQKDISNIVNKLKNKNKKSKR---------
>ZYRO0F09944g
--MVEDRGSKGSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGR
RI----TGESKDLKDFDKYFEKEGKEGK-------EDESSSSSEDEEEE---------TE
SKVVDRARGELPEAYTSSESEDSESDLSEEESEADV---------AEAV--EEAKPESGD
PSKTLAVVNLDWDHVRAADLMITFSSFLPSGGKIEKICIYPSEFGKERMQREEKEGPPRE
IFNKKKKH-------------HDEDSDSDVDIRDLYEEGDADKEVDNAALRQYQLERLRY
YYAIVYCNNVETGESIYSNCDGTEYESTANIFDLRYVPEGMEFDDEPKDECKELPKNYKP
LEFSTDALQHSNVKLTWDETPTDRLEVSKRAFSQKELEDMDFQAYLASGTDESDGEENNN
EEAKNKLKSLVGQSL---------AYGKQ-------QEEEPDMEITFTPGLD----DSKP
QADEDHEETTIEKVKRKEQERRKARKQRLKELKQQAEQEKKEKLRSGKNK-KQVEDESD-
------AKSKAELELLM-MEDED-DTEKSLNKKAHFNMNEILKSEKEKKKKGKYQDKGKI
MEDEFKPDLNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEILEERSKRA---HKKRKPLA
DDGD----SKDNKHDISNIVNKLKKKGNNKKAKR-------
>Suva_2.538
--MAVDKLEKESVDARFAGIYNDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGR
KI--KDAHNTKELEDFDKYFEKE---AE---------------NEEDTEA--------DV
KATVDRARGEVPNDYVSSGDEFTSSDSE-SSGESEIESEEES---EVEA--EDAKPESGD
ASKTLAVVNLDWDHVKSEDLMITFSGFVPKGGKIERISVYPSEFGKERMQREEIEGPPKE
LFQRKKQVKASKK-----ENADDSDSDIDIGIKDLYEEGDADKDVDSRALRQYQLDRLRY
YYAIVDCSDISTARAIYENCDGTEYESTANMFDLRYVPDGMTFDDTARDACSTLPKNYRP
HQFSTDALQHSNVKLTWDETPADRVEVAKRAFTQKEIDDMDFKAYLASDSDESDEE--VN
EDAKSKLKSLVGGLG----FNSKKENANDG------DEEEVDMEITFTPALE----GGDE
KPIEGQEETSIEKIRRKEKERRKARKQKVKELKQQSEKEKRGKFKSANKK-HVADEEEIK
NN----AKSKAELELLM-DDDGDAEAESSINSKAHFNMNEILRSEKEKHKKSRYQKKERI
VEDNFTPDLEDPRFKEVFEDHDFAIDPTQPEYKGTQAMNKILKERGKRVH--DRKRKHGK
NEND-VTEDGNDNKNIGNLVNKLKKKSKSSKKIKV------
>Skud_4.635
--MAGDKSEKESIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGR
KI--KDARNNKELEDFDKYFEKE---AE---------------HDEDSEV--------AA
KIVVDRARGEVPSDYVSSSDEFTSSDSE-SSGESEVESEVEG---EVET--EDVAAESGD
VSKTLAVVNLDWDHVKSEDLMITFSSFVPRGGKIERIAIFPSEFGRERMEREEVEGPPKE
LFQKKNKNKHAKE-----KNSVGTDSDGDIGINDLYEEGDADKDVDSRALRQYQLDRLRY
YYAVVCCSDTTSAKAIYDNCDGTEYESTANMFDLRYVPDGMTFDDAARDECTSLPKNYRP
HQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMDFKAYLASDSDESDEQ--VD
EDAKNKLKSLVGGLD----FNMKKKGANDGK-----EEGEVDMEITFTPALE----GENE
KPIEGQDETTIEKIRRKEKERRKARKQKVKELKQQSEKDKKSKLKSVNKK-HVADEEEIK
NN----AKSKAELELLM-DEDDA-ETEGSMNSKAHFSMKEILRSEKEKHKRGRYQKKERI
VEDTFAPDLEDPRFKEVFEDHDFAIDPTQPEYKNTQAMSTILKERGKRVK--DKKRKHSD
NGND-VAKNGDSKKNIGNLVNKLKKKNKSSKKVKV------
>Smik_4.632
--MAEEKPQKEGADTRFAGIYSDPKFKNTRTKDHKIKLDSRFSKKDLEVQHKSKVDKYGR
KI--KNTQNNKELEDFDKYFQKE---AE---------------NDEDTEA--------SV
KTVVDRARGEISGDYVSSSDEFTSSDSE-SSEQSEVESEVES---EVEI--EDPKPECGD
VSKTLAVVNLDWDHVKSEDLMITFSSFVPKGGKLERVAIYPSEFGKERMQREEVEGPPKE
LFQKKNKNKVSRK-----KKSDESDSDIDIGINDLYEEGDADKDVDSRALRQYQLDRLRY
YYAIVYCSDITTSKAIYDNCDGTEYESTANMFDLRYVPDGMTFDDAVRDECTLLPKNYRP
HQFSTDALQHSNVKLTWDETPADRLEVAKRAFTQKEIDDMDFKAYLASDSDESDEQ--ID
EDAKNKLKSLVGGIN----FNSKKENVKD-------SDEEVDMEITFTPALE----GGNE
QPSEEQEETTIEKIRRKEKERRKARKQKVKELKQQSEKDKKTKLKSINKK-YAEGEEDIK
NN----AKAKAELELLM-DDDDA-EAQGTINNKAHFNMNEILRSEKEKNKKSRYQNKERI
VEDNFTPDLNDPRFKEVFEDHDFAIDPTQPEYKSTQAMNKILKERGKRVK--DKKRKHDG
SEND-IIKNGDSKGNIGNLVKKLKKKSKSSKKMAV------
>YDR365C
--MAGENPKKEGVDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGR
KI--KNAQNNRELEDFDKYFEKE---AE---------------NDEDSEV--------NA
KTVVDRARGEVPDDYVSSSDEFTSSDSE-SSGESEVESEEEN---EVEI--ENAKPESGD
ISKNLAVVNLDWDHVKSEDLMITFSSFVPKGGKIERVAIYPSEFGKERMQREEVEGPPKE
LFQKKNKNKTSKK-----KKTDDSDSDMDIGIKDLYEEGDADKDVDSRALRQYQLDRLRY
YYAIVYCSDTTTSKAIYDNCDGTEYESTANMFDLRYVPDGMTFDDDVRDECSILPKNYRP
HQFSTDALQHSSVKLTWDETPADRVEVAKRAFTQKEIDDMDFKAYLASDSDESDGQ--VD
EEAKNKLKSLVGDFG----FNSKKETPND-------EDEEVDMEITFTPALE----GGNE
KSSEDKEETTIEKIRRKEKERRKARKQKVKELKQQSEKDKKSKLKSVNKK-HTNDEEEIE
KN----AKSKAELELLM-DDDDDTETQGTINNKAHFNMNEILRSEKEKHKKGRYQKKERI
VEDTFTPDLEDPRFKEVFEDHDFAIDPTQPEFKGTQAMSKILKERSKRVK--NKKRKLGG
SENN-MTNNADDNEDIGNLVNKLKKKSKSSKKVKV------
>Kpol_1016.8
--MSGEDSMKQSSDPRFSGIYSDPKFKNSKRKNIKIKLDDRFDKSDLQIKHKSKVDKYGR
KL--KDVKDNKELEDFDKYFEKE---DE---------------EDKEEEIGTE-----AK
VKVLDRARGEVPSDYESSSEEFTSSDSE-SSGESEVDSDEES---EDEV--ETSKPESGD
SSKTLAVVNLDWDYVKSQDLMITFSSFLPKGGKIEKICIYPSEFGKERMAREEVEGPPRE
LFNKKKNKKSSKKSSK--DDDEDDESDSDVDIRELYEEGDAEKDVDSKALRQYQLERLRY
YYAVVYCNNIASAESIYENCDGTEYESSANIFDLRYVPDGTEFDDEPRDECLQLPKNYKV
RQFTTDALQHSNVKLTWDETPADRVEIAKRAFTQKEIEEMDFKAYLASDSDESEEE--PN
DDVKNKLKSLVSQST---TIGDKSIFDDKGDNN---EEDDVDMEITFTPGLGEG--GEDG
DEDKDNEETTIEKVRRKEKERRKARKDKLKQLKQQSENEKKEKLKELKKE-RNGNGKNTN
VD----AKAKAELELLM-MDDET-ESTSTLNKKAHFNMNEIVRSEKEKGKKSKYQDKNKI
VEDDFKPDLNDPRFKEIFEDHDFAIDPTQSEFKETTAMKEILKERSRRS---NKNKSNNK
RKHL-SSNDNNQKKNISNLVDKIKRKEKKMKHK--------
>CAGL0L11638g
------MSEEKSNDPRFSRIYNDPKFKKSNSKQLKIKLDDRFGKKDLEVARRAKVDKYGR
KI---KEGSSKDIEDFDKYFEKD---EK-------------SAEEESADEGDVA----KS
KKIVDRARGEVPSDYVSSEDEFTSSDSD-TSGDSDYDSEIES---GDEAQEEQTKVETGD
ATKTLAAVNLDWDHVRSVDMMVTFSSFLPKGGKIEKICIYPSEFGKERMKREEVEGPPRE
LFQKNKKKKK--------KNSSEDEEESDVDIKDLYEEGNADDQVDKRALRQYQLDRLRY
YYAVIYCNNVESAKAIYENCDGTEYESTANIIDLRYVPDGMDFDDEPKDQCEELPKNYKP
HQFSTDALQHSNVKLTWDETPVDRVEVAKRAFTQKEIEDMDFKAYLASDSDESEEE--VN
EEAKNKLKSLVGESL--------KIDGKDGSD----EDEGMDMEITFTPGLDEANAEGED
KDGEDNEETTIEKVRRKEKERRKARKQKLKELKQKSEEEKKQKLKSKHDE-PLS------
------DKKKAELELLM-MDEN--ESNSGINSKAHFNMNEILRSEKEKSKKGKFQKKQRI
VEDDFKPNLDDDRFKEVFEDHDFAIDPSQPEFKETKAMKEILKERRKR----SRDSKHGK
EEHT-------DKNDINKIVSKLKSKKHKK-----------
>KAFR0E03910
----MSEGGKKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGR
KT--KDEGSKKELDDFEKYFEKE---DE--------------EEKKDTEET-------EE
KPKVDRARGEVPSDYVSSSDEYTSSESE-DSEEEELDSDVES---EVEI--ENTKPETGD
ASKTLAVVNLDWDHVKSADLMVTFSSFVPKGGKISRICIYPSEFGKERLQREEVEGPPKE
LFQKKNKKKA--------SHKEDFDSDSDVDIKDLYEEGDAEKDVDSKALRQYQLERLRY
YYAVVYCNNIDTARAIYENCDGTEYESTANMFDLRYVPDGMTFDDEPRDECNSLPKNYKP
MQFSTDALQHSNVKLTWDETPADRVEVAKRAFSQKEIEDMDFKAYLASDSDESEEE--VN
ENSKNKLKALVGESL---DFGTNGASD---------GESEVDMEITFTPGLD-----EAK
ESEEEKEESTIEKVRRKEKERRKARKDKLKQLKKDAENEKKEKMRSLHDK-KSRKAETEN
EEA---AKAKAELELLM-IEDED-DTEQSLNKKAHFNLNEIIRSEKEKGKKGKYQRKEKI
VEDDFKPDLSDPRFKEVFEDHDFAIDPSQPEFKQTNAMKQILNERSKRSKERSKGGKNKK
RKLD-TSTSKNGKNAISNIVNKLKKNGKQNNRTSV------
>NDAI0B05640
-MAPSNSENKESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGR
KL-ADSKGNEKEMNDFDKYFEKD---DEKKESEEIATEKSVSVEEKEDEEEERKETELED
DTNIDRARGDVPADYVSSSDEYTSSESE-ASDEEELDSDVES---GEEV--TTQEPESGE
PSKTLAVVNLDWDHVKSSDLMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKE
LFQKRKKKTSKSKKI---SDEANDSDVSDVDIKDLYEEGDADKDVDTKALRQYQLERLRY
YYAVVYCNNIETATAIYQNCDGTEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKP
HQFSTDALQHSNVKLTWDETPVERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDE--LN
EDAKNKLKALVGGGG----FGSREIFGGKGAKAGE-DEDEVDMEITFNPALD----ENSP
KEDGEHEETTIEKVARKEKERRKARKQKLKELKTKAQQEKKDKLKLSKNKKNHTKEDDAE
AKKN--QKSRAELELLM-MDDDE-ETGSTINNKAHFNMNEILRSEKEKGKRGKYQNKDKI
VEDEFKPDLNDPRFKEVFEDHDFAIDPSRPEFKETKAMKEILKERSKRI---HKKGSNKK
RRLSITENAGAESSDITNIVNKLKTKSTSKSKKSKKSEYLK
>NCAS0F03350
--MSEDNSTKGTDDSRFSGIYNDPKFRKTKNKNLKIKLDERFSKKDLEIRRKAKVDKYGR
KIHEDNDMNNKELKDFDKYFEKE---GE-------------SADEKKEEEE-------IE
TVTVDRARGEVPADYVSSSDEYTSSESE-DSGESDLESEGES---EIEV--DEATPETGD
ATKTLAVVNLDWDHVRSSDLMITFSGFLPKGGKIEKIVVLPSEFGKERMQREETEGPPRE
LFQKKKKKGKR-------ASVESDSDDSDVDIKDLYEEGDADKDVDTRALRQYQLERLRY
YYAVVYCNSVEAARAIYENCDGTEYESTANMFDLRYVPDGMDFDDEPRDQCSSLPKNYKP
HQFSTDALQHSNVKLTWDETPAERVEVAKRAFTQKEIEDMDFKAYLASDSDGSEDE--VN
QDAKNKLKSLVGDSL---RIGNQPIFGSKDTLEG--EDEEVDMEITFDPGLS----EGVE
KTE-EHEETTIEKVARKEKERRKARKQKLKELKNNAQKEKKDKLKSLKGK-KHNDSTEGD
AST---AKSKAELELLM-MDDED-DTETGINKKAHFNMKEILRSEKEKSKKGKYQDKRRI
VEDNFKPDLNDPRFKEVFEDHDFAIDPSRPEFKETPAMKEILKERSKRS---SKNAQKKK
RSHSLMDNQANETSDISNIVSKLKKKGGKGPKKSRYNN---