MUSCLE (3.8) multiple sequence alignment

TBLA0A03110        ----MKQLAPNWI-------VLVCLYPSIMLFGSLTGSLGGYNKSNGNGHNDIDDLPSEP
KLLA0B10153g       MRPDRIVLAKFPVPGD----WWLHIYPALVIFGYFISVLIG------------EDELERE
TPHA0E01130        -MQHAIEKLRHLQKNHFPLFAISISYIFVLLFGEFLHLILG------------TETLEYH
AGR350C            --MRLQGKMDEYISER----RYCYLYPALLLGGEVIKLILG------------EETIEHD
KNAG0C05510        ---MLLDKL-IW---P----NVVLLYPFVLSIGLILHVLVP------------EQVQDQL
Ecym_8183          MFEKISSNMNSFIVNQ----RYILVYPSLVFGGAVMRLLAG------------SERLESV
CAGL0H07117g       ---MFVPTR------K----QVSLAYPVILILGCFLSVLLS------------EEAKINQ
KAFR0C01860        MKLSLLPPL-----------IISLIYPCILFLGLFLSAVIS------------DETKSYQ
NDAI0C04310        ---MKILPI-PW---P----QICYIYPTILFIGVLINSLLP------------NETLQSH
NCAS0F02860        ---MRAY-F-KW---P----NVCLVYPTILVLGTIINTIVR------------EETLDRQ
SAKL0G08866g       -MNNYVEKTVLS---R----SFVWFYPLVLLLGLLVNLLVS------------AQELDRQ
KLTH0H14828g       -MDKFIERG-----------RFAFVYPVVLICGLVVHLLAN------------GSTLQHQ
Kwal_34.15984      -MDKFIEKA-----------QFTLVYPSILAYGSLINLLVD------------ASRLERQ
ZYRO0D10142g       ---MRLTPL-DW---K----KAAIVYPIELVVGCTLAFLMG------------HERLESQ
TDEL0E02770        -MLLLIPEV-TP---K----IAASIYPLELVLGCVIAWILG------------EDRLELQ
Kpol_339.11        ---MGFSEL------R----VVSLIYPFEVLIGWALSKIIG------------DLKLESQ
YDR319C            ----MIRQLNYW--SR----KAYLIYPFQVFVGALLSIVVS------------SETLNHQ
Suva_2.488         ----MIRQLSYW--SR----KAYLVYPIQVLVGAVISILVS------------EETLNHQ
Smik_4.578         ----MIRQLSYW--SR----KAYLIYPFQVLVGALISILVS------------PKTLDHQ
Skud_4.585         ----MIRQLGYW--SR----KAYLIYPFQVLVGAIISILVS------------SETLGHQ
                                            *   :  *     :                     

TBLA0A03110        SDKFWLIRSNSWFNQLFAYNGNTVFLGLFLIIVSLQVYF--SREDARLSLPIEIRTISRI
KLLA0B10153g       RKEWYWIGGRNVVNHLFAYKGIYIFDVLFGLLIGLQVYVRMKHEESLLPTSNGEQDRNSP
TPHA0E01130        KTSFYFLNSKNTINQIFAYNGNLVWFLLFCLVFYLHLHFETVNSKELLPTSADVPVGLHS
AGR350C            RKTWYLLNGGNFVNQLFVHHGVLLWTLLMGLVLALQYHVR-TTEFDPLPL--DARELGPV
KNAG0C05510        KQHVYFFNSKNVLNQVFAYKGNLVWTVLFLYIAVLSYFIK-TMSRDPL----EQRAGGRQ
Ecym_8183          RKSWYLLTEGNMVNYLFVINGNNVWLVLYILMAGVQCYIR-TKESDSLPLGGSVPGSSSR
CAGL0H07117g       RANYYLLNSKNVFNQILAYKGNWVWLFLFMGVAAVQYNLR-TKSQSLLPTDTRALVVSNK
KAFR0C01860        KDRIYLLRSSNIINEIFAYNGNLVWFILFSFVASLQIYIR-SHTFILLPHDIVDVDSKEN
NDAI0C04310        KSNYYVLNSKNIFNQVMAYNGNKVWSILFILLSVIQIRLQ-STNINLLPRHVDSAASKRR
NCAS0F02860        KHEYYILSSKNILNRVFAYNGNLIWAMLFGMMAYFQVWIR-IRTQDLLPR--DAQIINRQ
SAKL0G08866g       KHEYYLLSSRNVINKVFAYQGNQIFLITFILLAALQIHIH-SKNQDLLPR--NSSSSPRT
KLTH0H14828g       KDTYYLLSPNNVINLVFAYKGNLIWTILFVSLAAYQIKIR-VSRSDLLPR--DARTTYPA
Kwal_34.15984      RSSYYLLSSGNIVNKLFAYRGNLTWTILFTLLAVFQVWLH-AEQSDLLPR--DARSVHRV
ZYRO0D10142g       RKEHYFLNPNNFINQIFAYRGNQIWTILFCGLAGLQVYMK-THVPDVIPR--DARTIVRK
TDEL0E02770        RRTYYLLESKNIINGIFAYKGNLVWTVDFVCLALVQIYVK-CRNHALLPR--DARTNSSG
Kpol_339.11        RNNFYILRSSNIVNELFAYHGNQVWLVLFIFLCLVQIYYR-SKRFSLL---ISSESFNGR
YDR319C            KETCALLKSSNIFNVIFAYKANQLWPFLFFSLAFLQIYFHYLARMDILPLPISSTETSSS
Suva_2.488         KKTYTLLKSSNLLNIIFAYKANKIWPIFFFSLALLQIYFHYLARLDVLPLPISSSDTGST
Smik_4.578         KKTHVLLKSSNLFNTIFAYKANQLWPILFFSLAFLQVYFHYLARMDVLPLPISSSQTRPS
Skud_4.585         KKTYALLKSSNLFNILFAYKANQLWPFLFFSLAFLQIYFHYLARMDVLPLPISSSETGPT
                         :   . .* ::. ..   :      :               :            

TBLA0A03110        KQFQTKHYLR--IAK---------EYICKLILKYFFLYLEFLFIDHLFVLTGGYCTNGSG
KLLA0B10153g       DLLKQVGK----VLK---------VYSIKFVLVYLVLWACFLFIDHLFVWTGGNCDLSD-
TPHA0E01130        RVCQYTQRANYYLFK---------QYFFKYCVKSASLFVIFFAIDTLFVLSGGSCDDGSG
AGR350C            -----KRHP---LKM---LGSMAVQTVIKVLLVVTVLQALFWFMDHLFVWTGGRCTVSD-
KNAG0C05510        -----VDWQ---IVR---------QYCWKLLLKNGLLYLCFLVIDGVFIATGGVCTTMGG
Ecym_8183          -ERYTIFLC---LVK---------QFIVKLALKMVLLDRIFWLIDHVFIWTGGRCTVSD-
CAGL0H07117g       -----TKLQ---IIK---------EYFCKYFLKLFILDVIFLVIDGVFIMTGGSCTVPNR
KAFR0C01860        -----VRAK---LLK---------EYMVKFLLKVFILFVCFLIIDNIFILTGGSCAPGGA
NDAI0C04310        -----HVNS---LIK---------QYVIKFVLKNVLLAFLFLIIDSLFILTGGECNLIED
NCAS0F02860        -----RLQR---LIK---------QYIVKFVLKYLLLFITFLFIDGLFLFTGGQCTYGLG
SAKL0G08866g       -----EAAG---LAR---------QYAIKFLLKQLLLYVVFYIIDHVFIWTGGVCSISK-
KLTH0H14828g       -----RWHR---LGK---------EYAVKIILKNLLLYVIFFVIDCVFVWTGGSCSSSA-
Kwal_34.15984      -----GGVR---LAK---------QYTVKLILKNVLLYLAFLFIDNLFVWTGGSCSTSS-
ZYRO0D10142g       -----PMTS---LLK---------EYAVKIILKNLLLAIIFLFIDNIFILTGGSCSDHSG
TDEL0E02770        -----PLKS---LLK---------QYTSKIILKNVLLAITFFIIDSIFVLTGGSCLNGDV
Kpol_339.11        DQLIARGKP---LVK---------QYICKLILKNLMLILVFSVIDNVFIFSGGECTSGSG
YDR319C            YLTYTNHWP---LLKNRIISIMITQYACKFVLKYLLLFLNFQFIDHVFIWTGGECSSGSK
Suva_2.488         YLSYGNRRP---LLKDRVITTMAAQYACKFVLKNLLLFLSFQFIDHVFVWTGGQCSSGSG
Smik_4.578         YLTYPNRWL---LLKNRVTIIMIAQYACKFILKYMLLFLSFQFIDHVFIWTGGECSSGSG
Skud_4.585         YSSYINRWP---LLKDRVIGIMFAQYACKFILKSLLLYVCFQFIDHVFIWTGGECSSGSG
                               :               *  :    *   *  :* :*: :** *     

TBLA0A03110        ----TRDAMICRSGNGEWVGGFDISGHFCFLVTLSLIIWLELFKLEEFIRSRD-L-----
KLLA0B10153g       ----TKSAEKCRSLGGSWVGGFDISGHFCFLTNISLTLWQELKLLLQYANQHT-------
TPHA0E01130        ----TTFSETCRSNKGKWEGGFDISGHFCFLITISLILWCELYKLHKRMESES-F-----
AGR350C            ----TKDSVACRRLGGEWVGGFDISGHFCLVMNLSLVLWLELTELQRYMHSQE-------
KNAG0C05510        EMRKIRSAESCKWNGGQWENGFDISGHFCFLMNISLILWAELQLLQDAIRREE-LGEEEL
Ecym_8183          ----TKSSMECYRLHGKWVGGFDISGHFCFVTNLSLILWCELFSLEQYLSANE-------
CAGL0H07117g       ----SISAELCKSLGGKWIGGFDISGHFCFLVNISMILWMELIAIAEHVCGYD-T-----
KAFR0C01860        ----TRSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYTEEEE-L-----
NDAI0C04310        ----IWSAEHCKAKGGRWEGGFDISGHFCFLINISLILWSELSLLNKVLEDREET-----
NCAS0F02860        ----IWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILERYLRDEE-------
SAKL0G08866g       ----TRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHYQKYISDNE-------
KLTH0H14828g       ----TKSAERCRKEGGKWENGFDISGHFCFLTNVSLILWLELSSIQKYLNSDE-------
Kwal_34.15984      ----TRSAERCRKEGGSWDNGFDISGHFCFLTNISLILWYELRSIQKKISSDD-------
ZYRO0D10142g       ----THSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHLESWLIEED-M-----
TDEL0E02770        ----TRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQFRSYMERES-V-----
Kpol_339.11        ----TRSSQRCRHENGHWEGGFDISGHFCFLVTISMILWIELHQFKKHVDLEG-L-----
YDR319C            ----TTSAEKCRLENGKWDGGFDISGHFCFLVSISMILWMELHLFSRFVQAED-M-----
Suva_2.488         ----TTSAEKCRLEKGKWYGGFDISGHFCFLVNISMILWMELHLFSRFVQAED-M-----
Smik_4.578         ----TRSAEKCRLENGKWHGGFDISGHFCFLVNISMILWMELHMFCRFIQSED-M-----
Skud_4.585         ----TTSAEKCRLENGKWQGGFDISGHFCFLVNISMILWMELHLFSKFVQAED-M-----
                          :  *    * * .*********:: .:*: :* **                  

TBLA0A03110        -KSNVTNEVIFMVFFIVSILILWIVMLCVTSLYYHTFVEKLLGCIMGYICPIVMYRVLPR
KLLA0B10153g       --ISWNSPSSKYQWIVLLVLCIWINVLTITSIYYHTFPEKVLGCAFGYSCLLVIYYILPR
TPHA0E01130        -EVELNVVFTVMIGLIVGVIMVWFGLLWITAIYYHTFFEKVLGCMLGFVTPLLMYYTIPS
AGR350C            --IQLRK-FAWARTTVLGALGVWLALLAITAIYYHTFVEKLLGTIFGYSTSLVIYYVLPR
KNAG0C05510        NLWICYKWLRHGLTAVKITLYIWLFLLFVTASFYHTSSEKLIGCAFGYVCPFVMYHLIPT
Ecym_8183          --IRLRKRLIWIKYMILLALVTWIFILWVTALFYHTLLEKVLGLILGYVCPVVMYAIIPY
CAGL0H07117g       -VISLSSLQKHVITVAVVVLVAWMGMLLVTATYYHTIAEKLIGCVFGYICPFVMYGLIPN
KAFR0C01860        -QSRINKWIKRSLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYWLIPN
NDAI0C04310        -FTKIDKWMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGCILGFVCPIVMYYFIPN
NCAS0F02860        --LEMETIITNYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCPLIMYWLIPN
SAKL0G08866g       --LRVNRKFAWIKYLTLFVLVVWLFVLSVTATYYHTVGEKVLGLVMGYTCPTVMYILIPS
KLTH0H14828g       --RTPSKLWRVLLYSNVSVLVIWAFVLSVTAIYYHTTLEKILGLLMGYICPVIMYWLVPS
Kwal_34.15984      --ISPTKTWIVLRWSTLIVLITWSFILSVTAVYYHTLLEKVLGLTMGYLCPTIMYLVIPN
ZYRO0D10142g       -VKRLNVWGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCAMGYICPIIMYWLIPN
TDEL0E02770        -VFPVSKVVNGVLVVSSGVLGIWVLMLMVTAVYYHTVLEKVLGCALGYVCVLVMYWLIPR
Kpol_339.11        -SGQLSLYSKIILMTVFTVLCIWVFILFITSVYYHTFMEKVLGCAMGYITPYVMYHIIPN
YDR319C            -FWVVNKWVRACLAIVCAVLVIWICILWVTAIYYHTILEKVLGCLMGFICPVFIYHILPK
Suva_2.488         -LWVVNKWVRACLVIISVVLLIWIGILWVTAIYYHTILEKMLGCLMGYICPVFIYHILPR
Smik_4.578         -VWVVNKWVRACLAVICTVLIIWICILWVTAIYYHTILEKILGCLMGYICPIFIYHILPK
Skud_4.585         -FWVANKWVRACLAVISSILVIWICILWVTAIYYHTVLEKILGCFMGYICPIFIYHVLPK
                                      :  *  :* :*: :***  **::*  :*:    .:*  :* 

TBLA0A03110        NTIFTRYIYK----
KLLA0B10153g       IKHVNKFLTL----
TPHA0E01130        NEFLNGLLYK----
AGR350C            INR--GLHYL----
KNAG0C05510        SPRLNEFFYG----
Ecym_8183          YPKLQRILY-----
CAGL0H07117g       SHDLNKLFYATMSD
KAFR0C01860        QPRMKSLLYAF---
NDAI0C04310        NVKLKQTLYK----
NCAS0F02860        HYKLNHILYS----
SAKL0G08866g       TTKLNKLMY-----
KLTH0H14828g       HTALRQLLY-----
Kwal_34.15984      HSGLRSLLY-----
ZYRO0D10142g       HDIVRKVLY-----
TDEL0E02770        SRRFNGLLYS----
Kpol_339.11        NEFLYSILYH----
YDR319C            IGILHNYLYL----
Suva_2.488         IELLHDYLYI----
Smik_4.578         IELLHNYIHI----
Skud_4.585         IGLLHDYIYI----
                                 

FASTA FORMAT for MUSCLE Version 3.6

>TBLA0A03110
----MKQLAPNWI-------VLVCLYPSIMLFGSLTGSLGGYNKSNGNGHNDIDDLPSEP
SDKFWLIRSNSWFNQLFAYNGNTVFLGLFLIIVSLQVYF--SREDARLSLPIEIRTISRI
KQFQTKHYLR--IAK---------EYICKLILKYFFLYLEFLFIDHLFVLTGGYCTNGSG
----TRDAMICRSGNGEWVGGFDISGHFCFLVTLSLIIWLELFKLEEFIRSRD-L-----
-KSNVTNEVIFMVFFIVSILILWIVMLCVTSLYYHTFVEKLLGCIMGYICPIVMYRVLPR
NTIFTRYIYK----
>KLLA0B10153g
MRPDRIVLAKFPVPGD----WWLHIYPALVIFGYFISVLIG------------EDELERE
RKEWYWIGGRNVVNHLFAYKGIYIFDVLFGLLIGLQVYVRMKHEESLLPTSNGEQDRNSP
DLLKQVGK----VLK---------VYSIKFVLVYLVLWACFLFIDHLFVWTGGNCDLSD-
----TKSAEKCRSLGGSWVGGFDISGHFCFLTNISLTLWQELKLLLQYANQHT-------
--ISWNSPSSKYQWIVLLVLCIWINVLTITSIYYHTFPEKVLGCAFGYSCLLVIYYILPR
IKHVNKFLTL----
>TPHA0E01130
-MQHAIEKLRHLQKNHFPLFAISISYIFVLLFGEFLHLILG------------TETLEYH
KTSFYFLNSKNTINQIFAYNGNLVWFLLFCLVFYLHLHFETVNSKELLPTSADVPVGLHS
RVCQYTQRANYYLFK---------QYFFKYCVKSASLFVIFFAIDTLFVLSGGSCDDGSG
----TTFSETCRSNKGKWEGGFDISGHFCFLITISLILWCELYKLHKRMESES-F-----
-EVELNVVFTVMIGLIVGVIMVWFGLLWITAIYYHTFFEKVLGCMLGFVTPLLMYYTIPS
NEFLNGLLYK----
>AGR350C
--MRLQGKMDEYISER----RYCYLYPALLLGGEVIKLILG------------EETIEHD
RKTWYLLNGGNFVNQLFVHHGVLLWTLLMGLVLALQYHVR-TTEFDPLPL--DARELGPV
-----KRHP---LKM---LGSMAVQTVIKVLLVVTVLQALFWFMDHLFVWTGGRCTVSD-
----TKDSVACRRLGGEWVGGFDISGHFCLVMNLSLVLWLELTELQRYMHSQE-------
--IQLRK-FAWARTTVLGALGVWLALLAITAIYYHTFVEKLLGTIFGYSTSLVIYYVLPR
INR--GLHYL----
>KNAG0C05510
---MLLDKL-IW---P----NVVLLYPFVLSIGLILHVLVP------------EQVQDQL
KQHVYFFNSKNVLNQVFAYKGNLVWTVLFLYIAVLSYFIK-TMSRDPL----EQRAGGRQ
-----VDWQ---IVR---------QYCWKLLLKNGLLYLCFLVIDGVFIATGGVCTTMGG
EMRKIRSAESCKWNGGQWENGFDISGHFCFLMNISLILWAELQLLQDAIRREE-LGEEEL
NLWICYKWLRHGLTAVKITLYIWLFLLFVTASFYHTSSEKLIGCAFGYVCPFVMYHLIPT
SPRLNEFFYG----
>Ecym_8183
MFEKISSNMNSFIVNQ----RYILVYPSLVFGGAVMRLLAG------------SERLESV
RKSWYLLTEGNMVNYLFVINGNNVWLVLYILMAGVQCYIR-TKESDSLPLGGSVPGSSSR
-ERYTIFLC---LVK---------QFIVKLALKMVLLDRIFWLIDHVFIWTGGRCTVSD-
----TKSSMECYRLHGKWVGGFDISGHFCFVTNLSLILWCELFSLEQYLSANE-------
--IRLRKRLIWIKYMILLALVTWIFILWVTALFYHTLLEKVLGLILGYVCPVVMYAIIPY
YPKLQRILY-----
>CAGL0H07117g
---MFVPTR------K----QVSLAYPVILILGCFLSVLLS------------EEAKINQ
RANYYLLNSKNVFNQILAYKGNWVWLFLFMGVAAVQYNLR-TKSQSLLPTDTRALVVSNK
-----TKLQ---IIK---------EYFCKYFLKLFILDVIFLVIDGVFIMTGGSCTVPNR
----SISAELCKSLGGKWIGGFDISGHFCFLVNISMILWMELIAIAEHVCGYD-T-----
-VISLSSLQKHVITVAVVVLVAWMGMLLVTATYYHTIAEKLIGCVFGYICPFVMYGLIPN
SHDLNKLFYATMSD
>KAFR0C01860
MKLSLLPPL-----------IISLIYPCILFLGLFLSAVIS------------DETKSYQ
KDRIYLLRSSNIINEIFAYNGNLVWFILFSFVASLQIYIR-SHTFILLPHDIVDVDSKEN
-----VRAK---LLK---------EYMVKFLLKVFILFVCFLIIDNIFILTGGSCAPGGA
----TRSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHYSKYTEEEE-L-----
-QSRINKWIKRSLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPLVMYWLIPN
QPRMKSLLYAF---
>NDAI0C04310
---MKILPI-PW---P----QICYIYPTILFIGVLINSLLP------------NETLQSH
KSNYYVLNSKNIFNQVMAYNGNKVWSILFILLSVIQIRLQ-STNINLLPRHVDSAASKRR
-----HVNS---LIK---------QYVIKFVLKNVLLAFLFLIIDSLFILTGGECNLIED
----IWSAEHCKAKGGRWEGGFDISGHFCFLINISLILWSELSLLNKVLEDREET-----
-FTKIDKWMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGCILGFVCPIVMYYFIPN
NVKLKQTLYK----
>NCAS0F02860
---MRAY-F-KW---P----NVCLVYPTILVLGTIINTIVR------------EETLDRQ
KHEYYILSSKNILNRVFAYNGNLIWAMLFGMMAYFQVWIR-IRTQDLLPR--DAQIINRQ
-----RLQR---LIK---------QYIVKFVLKYLLLFITFLFIDGLFLFTGGQCTYGLG
----IWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILERYLRDEE-------
--LEMETIITNYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYCCPLIMYWLIPN
HYKLNHILYS----
>SAKL0G08866g
-MNNYVEKTVLS---R----SFVWFYPLVLLLGLLVNLLVS------------AQELDRQ
KHEYYLLSSRNVINKVFAYQGNQIFLITFILLAALQIHIH-SKNQDLLPR--NSSSSPRT
-----EAAG---LAR---------QYAIKFLLKQLLLYVVFYIIDHVFIWTGGVCSISK-
----TRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHYQKYISDNE-------
--LRVNRKFAWIKYLTLFVLVVWLFVLSVTATYYHTVGEKVLGLVMGYTCPTVMYILIPS
TTKLNKLMY-----
>KLTH0H14828g
-MDKFIERG-----------RFAFVYPVVLICGLVVHLLAN------------GSTLQHQ
KDTYYLLSPNNVINLVFAYKGNLIWTILFVSLAAYQIKIR-VSRSDLLPR--DARTTYPA
-----RWHR---LGK---------EYAVKIILKNLLLYVIFFVIDCVFVWTGGSCSSSA-
----TKSAERCRKEGGKWENGFDISGHFCFLTNVSLILWLELSSIQKYLNSDE-------
--RTPSKLWRVLLYSNVSVLVIWAFVLSVTAIYYHTTLEKILGLLMGYICPVIMYWLVPS
HTALRQLLY-----
>Kwal_34.15984
-MDKFIEKA-----------QFTLVYPSILAYGSLINLLVD------------ASRLERQ
RSSYYLLSSGNIVNKLFAYRGNLTWTILFTLLAVFQVWLH-AEQSDLLPR--DARSVHRV
-----GGVR---LAK---------QYTVKLILKNVLLYLAFLFIDNLFVWTGGSCSTSS-
----TRSAERCRKEGGSWDNGFDISGHFCFLTNISLILWYELRSIQKKISSDD-------
--ISPTKTWIVLRWSTLIVLITWSFILSVTAVYYHTLLEKVLGLTMGYLCPTIMYLVIPN
HSGLRSLLY-----
>ZYRO0D10142g
---MRLTPL-DW---K----KAAIVYPIELVVGCTLAFLMG------------HERLESQ
RKEHYFLNPNNFINQIFAYRGNQIWTILFCGLAGLQVYMK-THVPDVIPR--DARTIVRK
-----PMTS---LLK---------EYAVKIILKNLLLAIIFLFIDNIFILTGGSCSDHSG
----THSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHLESWLIEED-M-----
-VKRLNVWGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCAMGYICPIIMYWLIPN
HDIVRKVLY-----
>TDEL0E02770
-MLLLIPEV-TP---K----IAASIYPLELVLGCVIAWILG------------EDRLELQ
RRTYYLLESKNIINGIFAYKGNLVWTVDFVCLALVQIYVK-CRNHALLPR--DARTNSSG
-----PLKS---LLK---------QYTSKIILKNVLLAITFFIIDSIFVLTGGSCLNGDV
----TRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQFRSYMERES-V-----
-VFPVSKVVNGVLVVSSGVLGIWVLMLMVTAVYYHTVLEKVLGCALGYVCVLVMYWLIPR
SRRFNGLLYS----
>Kpol_339.11
---MGFSEL------R----VVSLIYPFEVLIGWALSKIIG------------DLKLESQ
RNNFYILRSSNIVNELFAYHGNQVWLVLFIFLCLVQIYYR-SKRFSLL---ISSESFNGR
DQLIARGKP---LVK---------QYICKLILKNLMLILVFSVIDNVFIFSGGECTSGSG
----TRSSQRCRHENGHWEGGFDISGHFCFLVTISMILWIELHQFKKHVDLEG-L-----
-SGQLSLYSKIILMTVFTVLCIWVFILFITSVYYHTFMEKVLGCAMGYITPYVMYHIIPN
NEFLYSILYH----
>YDR319C
----MIRQLNYW--SR----KAYLIYPFQVFVGALLSIVVS------------SETLNHQ
KETCALLKSSNIFNVIFAYKANQLWPFLFFSLAFLQIYFHYLARMDILPLPISSTETSSS
YLTYTNHWP---LLKNRIISIMITQYACKFVLKYLLLFLNFQFIDHVFIWTGGECSSGSK
----TTSAEKCRLENGKWDGGFDISGHFCFLVSISMILWMELHLFSRFVQAED-M-----
-FWVVNKWVRACLAIVCAVLVIWICILWVTAIYYHTILEKVLGCLMGFICPVFIYHILPK
IGILHNYLYL----
>Suva_2.488
----MIRQLSYW--SR----KAYLVYPIQVLVGAVISILVS------------EETLNHQ
KKTYTLLKSSNLLNIIFAYKANKIWPIFFFSLALLQIYFHYLARLDVLPLPISSSDTGST
YLSYGNRRP---LLKDRVITTMAAQYACKFVLKNLLLFLSFQFIDHVFVWTGGQCSSGSG
----TTSAEKCRLEKGKWYGGFDISGHFCFLVNISMILWMELHLFSRFVQAED-M-----
-LWVVNKWVRACLVIISVVLLIWIGILWVTAIYYHTILEKMLGCLMGYICPVFIYHILPR
IELLHDYLYI----
>Smik_4.578
----MIRQLSYW--SR----KAYLIYPFQVLVGALISILVS------------PKTLDHQ
KKTHVLLKSSNLFNTIFAYKANQLWPILFFSLAFLQVYFHYLARMDVLPLPISSSQTRPS
YLTYPNRWL---LLKNRVTIIMIAQYACKFILKYMLLFLSFQFIDHVFIWTGGECSSGSG
----TRSAEKCRLENGKWHGGFDISGHFCFLVNISMILWMELHMFCRFIQSED-M-----
-VWVVNKWVRACLAVICTVLIIWICILWVTAIYYHTILEKILGCLMGYICPIFIYHILPK
IELLHNYIHI----
>Skud_4.585
----MIRQLGYW--SR----KAYLIYPFQVLVGAIISILVS------------SETLGHQ
KKTYALLKSSNLFNILFAYKANQLWPFLFFSLAFLQIYFHYLARMDVLPLPISSSETGPT
YSSYINRWP---LLKDRVIGIMFAQYACKFILKSLLLYVCFQFIDHVFIWTGGECSSGSG
----TTSAEKCRLENGKWQGGFDISGHFCFLVNISMILWMELHLFSKFVQAED-M-----
-FWVANKWVRACLAVISSILVIWICILWVTAIYYHTVLEKILGCFMGYICPIFIYHVLPK
IGLLHDYIYI----