MUSCLE (3.8) multiple sequence alignment

KLLA0B10120g       ------------------------------------------------------------
TBLA0A03100        ------------------------------------------------------------
KAFR0C01880        ------------------------------------------------------------
AGR348W            -----------------MVALRTMHQIQNHPRKSSLNYHELKSKIRTTRDKLFKHECSGE
Ecym_8185          MTEEVREPPTITAFGSVRTVDTVNSGHYRLSRKTSLHYQDIKIKIKSTRNKLFKH-----
TPHA0D02060        --------------------------------------------------------MTGD
SAKL0G08910g       ------------------------MTDASAQDKLYYKKQLLKERIREKRSMLFKNAPDAS
KLTH0H14784g       ---------------------MGTTCVGVDPENPPTTNSSPLQRLKGKSGSIFKPRQETP
Kwal_34.15989      -------------------------MADENEEKRAPCKSVVKHRFRDRSGSIFKPRREVT
CAGL0H07161g       ------------------------------------------------------------
Kpol_1051.4        ------------------------------------------------------------
YDR317W            ------------------------------------------------------------
Smik_4.576         ------------------------------------------------------------
Suva_2.486         ------------------------------------------------------------
Skud_4.583         ------------------------------------------------------------
ZYRO0F00550g       ------------------------------------------------------------
TDEL0E02790        ------------------------------------------------------------
                                                                               

KLLA0B10120g       ------------------------------------------------------------
TBLA0A03100        ------------------------------------------------------------
KAFR0C01880        ------------------------------------------------------------
AGR348W            EDRHGSHSRDSAHGSQQKLPKEVKAAQKLVKQQLKLEQELARQEELKKLKLQQQSIALKQ
Ecym_8185          DQNQQIISTTTPVNS---------------------------------------------
TPHA0D02060        QSNIEIIKHTEEIIN---------------------------------------------
SAKL0G08910g       DVAANDHQHLVEKSP---------------------------------------------
KLTH0H14784g       IHRQNAIRHDQILIW---------------------------------------------
Kwal_34.15989      DQQQRAIRHDQILIS---------------------------------------------
CAGL0H07161g       ------------------------------------------------------------
Kpol_1051.4        ------------------------------------------------------------
YDR317W            ------------------------------------------------------------
Smik_4.576         ------------------------------------------------------------
Suva_2.486         ------------------------------------------------------------
Skud_4.583         ------------------------------------------------------------
ZYRO0F00550g       ------------------------------------------------------------
TDEL0E02790        ------------------------------------------------------------
                                                                               

KLLA0B10120g       ------------------------------------------------------------
TBLA0A03100        ------------------------------------------------------------
KAFR0C01880        ------------------------------------------------------------
AGR348W            QTEQLLKQQHSSPSQSPSQSRPSSQSEHSESQNSGSRTSSRPCTNSDSRPGSRHSVIRTN
Ecym_8185          --------------------------------------PPPPEDSSAAKAISVPKVSINP
TPHA0D02060        -----------------------------------------PDV-------------PIE
SAKL0G08910g       -----------------------------------------PEL----PDIEFEQQCGSL
KLTH0H14784g       -----------------------------------------PRQPSPVRSTDDLADGMVS
Kwal_34.15989      -----------------------------------------PQQRSLVQIARNADSEVLN
CAGL0H07161g       -----------------------------------------------MITTNLENTSGSL
Kpol_1051.4        ---------------------------------------------------MITYKLPTS
YDR317W            ----------------------------------------------------------MS
Smik_4.576         ----------------------------------------------------------MN
Suva_2.486         ----------------------------------------------------------MT
Skud_4.583         ----------------------------------------------------------MS
ZYRO0F00550g       -----------------------------------------------------MSTDHNL
TDEL0E02790        -----------------------------------------------------------M
                                                                               

KLLA0B10120g       --MPDF--YTLLLGGSGLTGKSVLQQMLSLPSYF--PVIDVPT-----------------
TBLA0A03100        ---MEQETNYIFFGSTGMTGFTTLTNLLNINSYL--QAKDPQSAIDNLPQDFQWQ-----
KAFR0C01880        -MSINSKEHILFFGSSGLVGSGSLSNLLNPNFLLCNKQNNFYDVIESSIVS---------
AGR348W            PALNDTGENYVLLGSTGLTGSQVLQDLITPWIGA--------------------------
Ecym_8185          PKVNEKGDNVIILGSTGLTGSQVLKGCMAPWTSG--------------------------
TPHA0D02060        SSIDRFSDNILVVGSTGLIGRNVLKSFFDTDLYI-KHSQELKRLIASSEYDSTT------
SAKL0G08910g       TTPNLLTDSYLLLGTTGLTGGIILNSLAEPWLYL-GTTNDVQDKIQMMFEAGDLSSESNP
KLTH0H14784g       LSTQRVTDNVLILGATGLTGSLILANLAQPWIYL-NATNDLQSKVDSLYPADLERFTKHN
Kwal_34.15989      VPSNRTVDSTLIFGITGLTGGLIAANLAQPWVYL-NATNDLQRKISSLFPFS-DQLEKHH
CAGL0H07161g       SREKTFEKNILLFGSTGLTGSLVFEYLLDPCFYL-NSAVELRELLLEAIEE---------
Kpol_1051.4        CPEKNFSEKIPIVGSTGLEEKWPLVSLLDINFYL-LNSNEIKQKLNPRSDIEIPSNHQ--
YDR317W            YSVNTFTDYVLLFGSSSLVGKGILENLLDINLYI-KNVSDLQGKLDSLSE----------
Smik_4.576         YRINAFTDYILLFGSSGLAGKGTLENMLDINFYI-KNVSDLQDKLNSLTE----------
Suva_2.486         NINNAFTDSILLFGSSGLAGKGTLENLLDINFYI-KNVSDLQDKLDSLTE----------
Skud_4.583         DNISVFTDYILLFGSSGLAGRGTLENLLDINFYI-KNVSDLQDKLDSLKE----------
ZYRO0F00550g       TKHQSFQDHILLFGSTGLIGSLTLEELLKVELYL-DAGNDLQSKLELYENS---------
TDEL0E02790        IVIQQYNDHFLFFGSSGLIGSLTLKELLKADLYL-GNPENIQKRLNTCEHL---------
                              ..* :.:                                          

KLLA0B10120g       ---------------LTSNLELNHHIIIITRS----------------------------
TBLA0A03100        ---------ACD---DSLDLYLVKNIFCINRR-------FFDSPIYLDEKIISSNISINY
KAFR0C01880        ---------------GVYDIAFDKIIYCFNRTPQNIRYKYHSDFEK-----NS---QFDF
AGR348W            ---------------PLEGVT-ARTFWCFSRK----FQDVEIDISNLPKTWTA---IVEF
Ecym_8185          ---------------VLYDLKLTKNIWCFNRR----LKTVDFSISKLPPTWTA---VVNY
TPHA0D02060        ---------------RIKEVTIKKTAYSLTRK---RQSVELFKNKTIVGQKLK---EVEL
SAKL0G08910g       PNVKRT---FGQILRGEKSIEITKNLFCFNRK--LALLEIPSTPEYINDYWEY---SIDY
KLTH0H14784g       IFVKKPKSPLCNILVRRKSIEVTKNLYCLARRPIAVEGMPL---DGLDASWEH---TVRC
Kwal_34.15989      HFMRRTRSPLCNLLTKEKSVEVTKNLFCFTRRSVTLEQICL---DGLDASWEH---SIDY
CAGL0H07161g       ---------------GLENVTIKTCLYCFNRKIGEPLDKYLKSPSANS---FG---PFCF
Kpol_1051.4        ---------------KMNTIKIVKNIFCINRR---SQTLDLFNKDALESVKVG---RIKF
YDR317W            ---------------IKGNVVLNKHVFCVNRRCINEEKSFMKTIDYIN---MR---SVTW
Smik_4.576         ---------------IKGDVVLNKHVFCINRRSITEEKSFMKSIDYIN---MK---SITW
Suva_2.486         ---------------INENVVLNKHIFCINRKSVTEQKSFIKTIDYVN---MK---SIIW
Skud_4.583         ---------------IKEDVVLNKHVFCINRRNVTEQKSFLKTIDYVN---MK---SITW
ZYRO0F00550g       ---------------DINHFTLNKFFYCVNRK-LNNEKRSPGNEYLMERCKAT---PLVF
TDEL0E02790        ---------------NLSNFRFNKLIYCINRK-IGYKNILLDNEQYLKADKLA---PISF
                                      .        . *                             

KLLA0B10120g       ---QFDL-----------------------------------------------------
TBLA0A03100        KDKTFEL---------------------------------------QFQSNTNSVSNNIT
KAFR0C01880        GGTKYTL-----------------------------------------------------
AGR348W            EGEKHVI---------------------------------------------RKND----
Ecym_8185          GGEPHII---------------------------------------------RKYD----
TPHA0D02060        DGKTFYLQFDLLKQINDSGEPKESFLKSLTTKKMLEALTHGKGVKVTSNSKENQGISVRN
SAKL0G08910g       KGTKYHS---------------------------------------------KKNN----
KLTH0H14784g       KGFDLIC---------------------------------------------GKGG----
Kwal_34.15989      KGSKMVC---------------------------------------------SKEN----
CAGL0H07161g       NGSQYHY---------------------------------------------NKGTCVPL
Kpol_1051.4        KDLEYRL-----------------------------------------------------
YDR317W            QGGRYYL---------------------------------------------RSRK----
Smik_4.576         KRGRYYL---------------------------------------------RSRN----
Suva_2.486         KGGRYYL---------------------------------------------RSRG----
Skud_4.583         KGGRYYL---------------------------------------------RSRT----
ZYRO0F00550g       RGQDYYL---------------------------------------------HNNT----
TDEL0E02790        NKADYRF---------------------------------------------EKIT----
                                                                               

KLLA0B10120g       --------GTEVEKISSMFQKSDLV---------------EWKCVFNESSNTISYS--TT
TBLA0A03100        EQNELKLPLVSTDCLRYFIDTGNIQLETTPGKENQILTTDEVWYHFNQQLCQLNFKQINL
KAFR0C01880        ---------SNNPEPNNSFESKGQLQFAINDVEERI----KIKYQVMPYSKEFGFS--AE
AGR348W            -----------VRLIRHLSECGGMLG---------------LKCHWDQYNWDVVLT--TG
Ecym_8185          -----------LKIKQHITEIGKLDG---------------LEFQWDQFDWELKLP--TD
TPHA0D02060        EESSILKKDKSLLFSVINYNESEGNVILQPQEYSNV----ECYFNLQQYDSSLIFA--SS
SAKL0G08910g       -----------ISFGVPTLKFGKLVNSNENSI--------TNQCQLQQFDYKFEFQ---R
KLTH0H14784g       -----ISRDCTLERNAAMYELASTHNCPGR----------EIILQLQSFSFKLVYE--NS
Kwal_34.15989      -----------LSCEEPFVKRGTTTFFQDASDAPAV----TLTIQLQKFTYHLNYD--NS
CAGL0H07161g       DIDQDIETSNDATFDGFLYYKDKGKNVTGKNPI-------SGEYYGKEYMYYLEYM--SA
Kpol_1051.4        -DKTPGETSYESSYLTNEIESGKINFDCEHPFS-------PLSFELQKKRAQLTYK--AK
YDR317W            EKDTEKVPSSPNTFCYDNFEEGFIKNTPEERGKDGY----SFVYNQKQFSYTLHYA--CG
Smik_4.576         ENETKKIPSNPDTFCYDAFEEGFIKKTTDENGKDNF----CIPYNQKRFSYALYYA--SG
Suva_2.486         ENETKRETCNSNTFCYDDFEEGIIRNSMDKDKKGTF----SFAYNRKQFSYALHYA--CG
Skud_4.583         ANDNGRETSSTDTFFYDNFEEGFIRGAAYEGQKGNF----SFAYNQKQFSYSLHYA--CR
ZYRO0F00550g       SATPPASQSSNPSLGNNVFEEDGTIQLTKTVDNRSV----TLRFRQTRKSYQLEYI--SK
TDEL0E02790        SICPSVKKHSNQSLVNNVSDESGTLYIHNNSAGN------VLKYHRSMQTYQVEYK--SE
                                                                       .       

KLLA0B10120g       IH----------DLISICVNVEVTTIKEPDSTKWAQMIPHHIFINDPSADL---------
TBLA0A03100        NENENDNDNVQEKFIKLNYIINIYQFVLPKSDTWLEVLP-NIFKPTTILHSKINCTWNYI
KAFR0C01880        EE----------QQLNVTYNVFHVQIVYNESEKWPDLLP-ILFTGENEIKI-----ARKR
AGR348W            EV--------------RNATINVVQVVQPDSRRWPDLFN-KMFTGGVRTFN---------
Ecym_8185          EV--------------KNVTVNVFQIIQNDSKKWDKTFS-ELFTGNRKPLN---------
TPHA0D02060        SG----------DILKINFDLKLYHLSAVDSTIWPSLLP-VLFDSNTKLVP-----NKGL
SAKL0G08910g       EDPSMQNLRTRAQTLIISLKINVIQILEPNSKLWPLLLH-STFGDTDTNVA-----LHVQ
KLTH0H14784g       RDPHGDTCG---HALMVKLNINVICVIDTDSQRWPALLT-DVFGEQPMKRG-----LIPQ
Kwal_34.15989      RDVHGETCR---HTLMIQLRVNIILIVEEDSQKWPMLLT-RIFGKHASKRP-----LIVK
CAGL0H07161g       EG----------NLLKLNFIFNHIQLIIKNSFSWPSVIP-IIFSDEVEAIS-----FR--
Kpol_1051.4        EG----------NMLQIQFEISVYHIIIPTSNQWPTLLP-RIFNPATVIEK-----VE-D
YDR317W            KE----------KGIEIICNFTVTQLIIPRSETWPKLLP-RIFSGTQKLEK-----FDID
Smik_4.576         KK----------EGFEIIYKFTVTQLIIPRSENWSRLLS-YIFSGTQKLEK-----FDAN
Suva_2.486         KD----------ESFGIKYNFIVTQLVIPQSTSWPKLLP-EVFSGTQKLER-----FDVD
Skud_4.583         KE----------ESFGIKYNFTVTQLIIPPSESWPRLLS-RIFSKEQKLEK-----FDID
ZYRO0F00550g       DL----------KNLLITFHFTIVQLVFEDSTRWADLLP-SIFSGEVELVP---------
TDEL0E02790        NS----------KKLLITFNFVILQIACPDSSKWCELLP-DIFSGCVALRS--------E
                                       .    .    *  *   :    *                 

KLLA0B10120g       -------------------SVISCLGSTSARSKRTGVARDWVDKILNLDILKAILNNDIL
TBLA0A03100        DQFTNEKSNIVLPKLEDIQVMICTLGTNLLCDQKK------IDFDLTFQLSNWFSNRLG-
KAFR0C01880        KD-RLFPELFKLANINDISTVVCTLGASSATAKKQNMTVNKIDYDLTYNLIRAFTTTEN-
AGR348W            -----AYSEIYMPAVTEIETLISTLGSTSWEARKSKAPRAFVDYTLNMQMAKTFAPDPK-
Ecym_8185          -----DRIEVYLPSIDQVETLISTLGSSSWESRKMKTPRSFVDYTLNMDMAKVFAPDQK-
TPHA0D02060        IE-NIDLTNEKLPLLSEVKVMLNSLGSRSHSPKNETFKN--IDYKLNLSLINSFNNTSD-
SAKL0G08910g       GQ---VPTPMIFPSLSKVNTLVSALGSTTFEQKKSHVSRDFVDYDLNFKMAEEFTTNSSE
KLTH0H14784g       GQGLEGISHWEFPSLGDVGTLVSALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKA-
Kwal_34.15989      DT--EEPILWTAPPLTQINTMVSSLGSKSFEKKKPKISRHFADYELNMLLAHAFCKDKT-
CAGL0H07161g       -E--KMPLKRYFPLLSDIKTMISTIGTTTNRNKISNTTYNDIDYQLNVDLVKAFSNTDD-
Kpol_1051.4        KE--NSILPTGLPDLKNIPTMISSLGLNHRQQITREKSYRAIDFDLTLKLTQTFANNNN-
YDR317W            NK--NYVPGRSLPSLCDISTMVCSLGSTSARVRRTQVPSSFADYYLPFNLAQEFTNTTN-
Smik_4.576         NK--TYVAGKSLPNLRDISTMVCTLGSTSARVRRTQVPNSFVDYSLPFSLAQEFTNTTD-
Suva_2.486         SR--DYVSDKSLPALNSIGTMVCALGSSAARVRKSQVPNSFVDYHLSFNLAQEFTNTTD-
Skud_4.583         NK--TYVADKSLPSLRDIGTMVCTLGSTSARVRRTQVPNSFVDYHLVFSLAQEFANTTN-
ZYRO0F00550g       EE--SNHTSPRLPHLDQVKTMICTLGPNSSSTKHSHYDRYFVEYQLTFQIVQNFASCED-
TDEL0E02790        AE--PDGTTNKLPPLDEIPTMICTLGAGS---RQSKAKRHYVDYELTFKLAQSFNNCEG-
                                       ::  :*                :  *   :   :      

KLLA0B10120g       SQKLSQYIIMTSFNNFAISRMFPYFKAKQELETNTQFLLQNHRASIVILRPGPLIG-KHG
TBLA0A03100        ----KKLVIVTAFNNSLLSKTFNYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLG-THV
KAFR0C01880        ----KKVIIVTSFNNALISNIFPYFRTKLRLENDLKTTLEPPIKELYILRPGPIKGKHRS
AGR348W            KGTVKHMVIVTSFNHLALGMVSQYFRTKQRLENDLTYDV-PGLTHLTILRPGPLLG-EHG
Ecym_8185          KSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDV-PGLTHLTILRPGPLIG-QHG
TPHA0D02060        ----KKVIIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINELVILRPGPLVGTPMT
SAKL0G08910g       HGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATRI-PELDELVILRPGPLIGSHTP
KLTH0H14784g       RGTRKKIVVVTSFNSSLLSTVSNYFQTKLKLEQDLYTKV-HGMDNLVLLRPGPLVGNHTP
Kwal_34.15989      RGLEKKIVIITSFNNLFLSSTSDYFQSKLMLEQDLVTKV-QALDKLVLLRPGPLVGNHTH
CAGL0H07161g       ----KSVIIVTSFNNTIISTVSPYFKIKMKLESTLANAITPPLKTLTILRPGPLVG-RHS
Kpol_1051.4        ----KKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNELNPKLSQLVILRPGPIVGVPMT
YDR317W            ----KRLVVTTAFNNDFLSKTFEYFRIKAKLENDLDEALPNKLKELVILRPGPMCG-QHG
Smik_4.576         ----KRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKELIILRPGPMCG-QHG
Suva_2.486         ----KKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKELIILRPGPMCG-QHG
Skud_4.583         ----KRLVVVTSFNNDLLMRTFEYFRIKAKLENDLEEALPNKLKELVILRPGPMCG-QHG
ZYRO0F00550g       ----KRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAPALAQLVVLRPGPIVG-NHV
TDEL0E02790        ----KRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGKLVVLRPGPLVG-EHG
                       .  :: *:.*         *:. *  :*      :      : :*****: *    

KLLA0B10120g       STSSFTVP---ELDDRLLHSILRYKKAIFHHYVRRMNEWKDVGIATRTSELVAQFSYNMP
TBLA0A03100        LNPSEEQAVVLNHSTKILKQLWFYKTFFSNHKC---------------------------
KAFR0C01880        KESEISTN---IRTLNPITRAIHYKKKLIKQKKKHW------------------------
AGR348W            SKPVISPT--NPDTGNMLTRCYTYKKNVMRTQFNWLAQVKEVGPTTKVTELVAKATYHLP
Ecym_8185          KQIILAPQ--LPVGSGVLYKCYAWKRSLLKAKLHWLSQVKDVGPSKKVTELIAKATYHLP
TPHA0D02060        TKLIPGLTAHLKRNDSSLKQLINYKRFAFDYKVALLRRIKYTGFEPTCTNILAKTFYRRP
SAKL0G08910g       EFIPGDPPKSTNGLLKPLSTVCYYKKACYDHKRHFLQSVTQVGLKTKMTEVFARLIYRSS
KLTH0H14784g       HAQTPPATNKFTFLPAALFHILVLKKRCFDRKVRLLRDLMKVGLRAKLSELGARLAYQHP
Kwal_34.15989      QLQSPSIIDKPSFIPTAMFKVLKFKKNCIERKLQLLREISQVGIRTKLSELMARLAYQRS
CAGL0H07161g       DIYPTNDS--ILKNSSLFERALLHKKAFLQNMECFVDDIRTGGMSIKASEIVARTFYRIP
Kpol_1051.4        DAINPEFNPILKKSDNLVEQSILLKKYLLDYKLATLKKYRSTGIAPRLTDILAKTMYRKP
YDR317W            NPINVELG---KENSTFLEKIFYYPHYLLVYKKKYISEARRIGLRTKLSEIIASSIYRMP
Smik_4.576         NSIKVELD--VQENLTFSDKILYYPRYLLMYKKQYISEVRKIGLRTKLSELIASSTYRMP
Suva_2.486         NPVHVEMD--IQQNPTLSERFFYYPRYILKYKQQCISEVRKVGLRTRLSEVIASSIYRMP
Skud_4.583         DPVNVKLD--VQENPTFSERILYYPRYVLKYKKQYISEARKVGLRTKLSELIASSIYRMP
ZYRO0F00550g       NLNDRDLR--LRYSPSLCEQLKHYKEWCWEYKKSFVKEIRKIGFKTKASELVAKAMYRKP
TDEL0E02790        RPLTKSLT--IGHSTNMLKQILYYKEYCFQCKLALFKEFRRIGFRTRASELIARTMYRKP
                                                                               

KLLA0B10120g       GAFFVGYPVKVLDCAHVIVTERVKHFK-LPS---LQPQKVTYF--SSQQIDSYKAKNEIA
TBLA0A03100        ------------------------------------------------------------
KAFR0C01880        --------------SYFTLMMPKRKF--LRC-----------------------------
AGR348W            GNWIVGYSIPAGRVAQIAAQEALVKRNYIKQNLRSSSMIVEVTIWSSQDMDTAETSNPA-
Ecym_8185          GNWIVGYSIPSSKVARIAAKEAMTKRNLARND--SDALVVEVTLWSSQEMDRALSGSVAL
TPHA0D02060        GTSLLGYTIPASKVAEVMVFKGLCVGLENVH---KDTK-VEIL--ESKTIDLLLE-----
SAKL0G08910g       CSWMFGYSVPVAKVAVVAAIRTIQKIQNDPE---SGGIRVQLI--KSDELDVMV------
KLTH0H14784g       CLQLVSSVNAAHKVAFFAASRAIY----SPD---SASF-VELI--KSDEIEKMAN-----
Kwal_34.15989      CSPLLGHVVPAYKVAFVASIRAVF----SPD---SASF-VELI--KSDEIEKMA------
CAGL0H07161g       GSKLLGYCIPAQKVAYAISIAAVDKY--LHE----EPL-TRVV--TSEEMDNMK------
Kpol_1051.4        GTSVLGYCIPATKVAKVAALKAIEPTIASTY---SKPD-VQII--TSRQIDELV------
YDR317W            GSALLGYAVPVSKVSYVASLMAIERK--SKE---AGPK-LEVI--SSYQIDMIV------
Smik_4.576         GSALLGYSVPVSKVSYVASLMAIERK--SKE---AGPK-MEVI--NSYQIDMIA------
Suva_2.486         GSALLGYSVPVSKVSYVASLMAIEKK--SKE---AGPK-VEVI--NSYQIDMIA------
Skud_4.583         GSALLGYSVPVSKVSYVTSLKAIEKR--SKE---AGPK-VEMI--NSYQIDMIA------
ZYRO0F00550g       GSSVLGYCVPASKAAYATAYMATNPT--LGE--------LRIV--TSKEIDHLT------
TDEL0E02790        GSWMLGYCIPATKAAYVAASKATDEA--SDE---ASDP-VEII--TSEQMDHIALH----
                                                                               

KLLA0B10120g       HIY
TBLA0A03100        ---
KAFR0C01880        ---
AGR348W            ---
Ecym_8185          ---
TPHA0D02060        ---
SAKL0G08910g       ---
KLTH0H14784g       ---
Kwal_34.15989      ---
CAGL0H07161g       ---
Kpol_1051.4        ---
YDR317W            ---
Smik_4.576         ---
Suva_2.486         ---
Skud_4.583         ---
ZYRO0F00550g       ---
TDEL0E02790        ---
                      

FASTA FORMAT for MUSCLE Version 3.6

>KLLA0B10120g
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
--MPDF--YTLLLGGSGLTGKSVLQQMLSLPSYF--PVIDVPT-----------------
---------------LTSNLELNHHIIIITRS----------------------------
---QFDL-----------------------------------------------------
--------GTEVEKISSMFQKSDLV---------------EWKCVFNESSNTISYS--TT
IH----------DLISICVNVEVTTIKEPDSTKWAQMIPHHIFINDPSADL---------
-------------------SVISCLGSTSARSKRTGVARDWVDKILNLDILKAILNNDIL
SQKLSQYIIMTSFNNFAISRMFPYFKAKQELETNTQFLLQNHRASIVILRPGPLIG-KHG
STSSFTVP---ELDDRLLHSILRYKKAIFHHYVRRMNEWKDVGIATRTSELVAQFSYNMP
GAFFVGYPVKVLDCAHVIVTERVKHFK-LPS---LQPQKVTYF--SSQQIDSYKAKNEIA
HIY
>TBLA0A03100
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
---MEQETNYIFFGSTGMTGFTTLTNLLNINSYL--QAKDPQSAIDNLPQDFQWQ-----
---------ACD---DSLDLYLVKNIFCINRR-------FFDSPIYLDEKIISSNISINY
KDKTFEL---------------------------------------QFQSNTNSVSNNIT
EQNELKLPLVSTDCLRYFIDTGNIQLETTPGKENQILTTDEVWYHFNQQLCQLNFKQINL
NENENDNDNVQEKFIKLNYIINIYQFVLPKSDTWLEVLP-NIFKPTTILHSKINCTWNYI
DQFTNEKSNIVLPKLEDIQVMICTLGTNLLCDQKK------IDFDLTFQLSNWFSNRLG-
----KKLVIVTAFNNSLLSKTFNYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLG-THV
LNPSEEQAVVLNHSTKILKQLWFYKTFFSNHKC---------------------------
------------------------------------------------------------
---
>KAFR0C01880
------------------------------------------------------------
------------------------------------------------------------
------------------------------------------------------------
-MSINSKEHILFFGSSGLVGSGSLSNLLNPNFLLCNKQNNFYDVIESSIVS---------
---------------GVYDIAFDKIIYCFNRTPQNIRYKYHSDFEK-----NS---QFDF
GGTKYTL-----------------------------------------------------
---------SNNPEPNNSFESKGQLQFAINDVEERI----KIKYQVMPYSKEFGFS--AE
EE----------QQLNVTYNVFHVQIVYNESEKWPDLLP-ILFTGENEIKI-----ARKR
KD-RLFPELFKLANINDISTVVCTLGASSATAKKQNMTVNKIDYDLTYNLIRAFTTTEN-
----KKVIIVTSFNNALISNIFPYFRTKLRLENDLKTTLEPPIKELYILRPGPIKGKHRS
KESEISTN---IRTLNPITRAIHYKKKLIKQKKKHW------------------------
--------------SYFTLMMPKRKF--LRC-----------------------------
---
>AGR348W
-----------------MVALRTMHQIQNHPRKSSLNYHELKSKIRTTRDKLFKHECSGE
EDRHGSHSRDSAHGSQQKLPKEVKAAQKLVKQQLKLEQELARQEELKKLKLQQQSIALKQ
QTEQLLKQQHSSPSQSPSQSRPSSQSEHSESQNSGSRTSSRPCTNSDSRPGSRHSVIRTN
PALNDTGENYVLLGSTGLTGSQVLQDLITPWIGA--------------------------
---------------PLEGVT-ARTFWCFSRK----FQDVEIDISNLPKTWTA---IVEF
EGEKHVI---------------------------------------------RKND----
-----------VRLIRHLSECGGMLG---------------LKCHWDQYNWDVVLT--TG
EV--------------RNATINVVQVVQPDSRRWPDLFN-KMFTGGVRTFN---------
-----AYSEIYMPAVTEIETLISTLGSTSWEARKSKAPRAFVDYTLNMQMAKTFAPDPK-
KGTVKHMVIVTSFNHLALGMVSQYFRTKQRLENDLTYDV-PGLTHLTILRPGPLLG-EHG
SKPVISPT--NPDTGNMLTRCYTYKKNVMRTQFNWLAQVKEVGPTTKVTELVAKATYHLP
GNWIVGYSIPAGRVAQIAAQEALVKRNYIKQNLRSSSMIVEVTIWSSQDMDTAETSNPA-
---
>Ecym_8185
MTEEVREPPTITAFGSVRTVDTVNSGHYRLSRKTSLHYQDIKIKIKSTRNKLFKH-----
DQNQQIISTTTPVNS---------------------------------------------
--------------------------------------PPPPEDSSAAKAISVPKVSINP
PKVNEKGDNVIILGSTGLTGSQVLKGCMAPWTSG--------------------------
---------------VLYDLKLTKNIWCFNRR----LKTVDFSISKLPPTWTA---VVNY
GGEPHII---------------------------------------------RKYD----
-----------LKIKQHITEIGKLDG---------------LEFQWDQFDWELKLP--TD
EV--------------KNVTVNVFQIIQNDSKKWDKTFS-ELFTGNRKPLN---------
-----DRIEVYLPSIDQVETLISTLGSSSWESRKMKTPRSFVDYTLNMDMAKVFAPDQK-
KSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDV-PGLTHLTILRPGPLIG-QHG
KQIILAPQ--LPVGSGVLYKCYAWKRSLLKAKLHWLSQVKDVGPSKKVTELIAKATYHLP
GNWIVGYSIPSSKVARIAAKEAMTKRNLARND--SDALVVEVTLWSSQEMDRALSGSVAL
---
>TPHA0D02060
--------------------------------------------------------MTGD
QSNIEIIKHTEEIIN---------------------------------------------
-----------------------------------------PDV-------------PIE
SSIDRFSDNILVVGSTGLIGRNVLKSFFDTDLYI-KHSQELKRLIASSEYDSTT------
---------------RIKEVTIKKTAYSLTRK---RQSVELFKNKTIVGQKLK---EVEL
DGKTFYLQFDLLKQINDSGEPKESFLKSLTTKKMLEALTHGKGVKVTSNSKENQGISVRN
EESSILKKDKSLLFSVINYNESEGNVILQPQEYSNV----ECYFNLQQYDSSLIFA--SS
SG----------DILKINFDLKLYHLSAVDSTIWPSLLP-VLFDSNTKLVP-----NKGL
IE-NIDLTNEKLPLLSEVKVMLNSLGSRSHSPKNETFKN--IDYKLNLSLINSFNNTSD-
----KKVIIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINELVILRPGPLVGTPMT
TKLIPGLTAHLKRNDSSLKQLINYKRFAFDYKVALLRRIKYTGFEPTCTNILAKTFYRRP
GTSLLGYTIPASKVAEVMVFKGLCVGLENVH---KDTK-VEIL--ESKTIDLLLE-----
---
>SAKL0G08910g
------------------------MTDASAQDKLYYKKQLLKERIREKRSMLFKNAPDAS
DVAANDHQHLVEKSP---------------------------------------------
-----------------------------------------PEL----PDIEFEQQCGSL
TTPNLLTDSYLLLGTTGLTGGIILNSLAEPWLYL-GTTNDVQDKIQMMFEAGDLSSESNP
PNVKRT---FGQILRGEKSIEITKNLFCFNRK--LALLEIPSTPEYINDYWEY---SIDY
KGTKYHS---------------------------------------------KKNN----
-----------ISFGVPTLKFGKLVNSNENSI--------TNQCQLQQFDYKFEFQ---R
EDPSMQNLRTRAQTLIISLKINVIQILEPNSKLWPLLLH-STFGDTDTNVA-----LHVQ
GQ---VPTPMIFPSLSKVNTLVSALGSTTFEQKKSHVSRDFVDYDLNFKMAEEFTTNSSE
HGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATRI-PELDELVILRPGPLIGSHTP
EFIPGDPPKSTNGLLKPLSTVCYYKKACYDHKRHFLQSVTQVGLKTKMTEVFARLIYRSS
CSWMFGYSVPVAKVAVVAAIRTIQKIQNDPE---SGGIRVQLI--KSDELDVMV------
---
>KLTH0H14784g
---------------------MGTTCVGVDPENPPTTNSSPLQRLKGKSGSIFKPRQETP
IHRQNAIRHDQILIW---------------------------------------------
-----------------------------------------PRQPSPVRSTDDLADGMVS
LSTQRVTDNVLILGATGLTGSLILANLAQPWIYL-NATNDLQSKVDSLYPADLERFTKHN
IFVKKPKSPLCNILVRRKSIEVTKNLYCLARRPIAVEGMPL---DGLDASWEH---TVRC
KGFDLIC---------------------------------------------GKGG----
-----ISRDCTLERNAAMYELASTHNCPGR----------EIILQLQSFSFKLVYE--NS
RDPHGDTCG---HALMVKLNINVICVIDTDSQRWPALLT-DVFGEQPMKRG-----LIPQ
GQGLEGISHWEFPSLGDVGTLVSALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKA-
RGTRKKIVVVTSFNSSLLSTVSNYFQTKLKLEQDLYTKV-HGMDNLVLLRPGPLVGNHTP
HAQTPPATNKFTFLPAALFHILVLKKRCFDRKVRLLRDLMKVGLRAKLSELGARLAYQHP
CLQLVSSVNAAHKVAFFAASRAIY----SPD---SASF-VELI--KSDEIEKMAN-----
---
>Kwal_34.15989
-------------------------MADENEEKRAPCKSVVKHRFRDRSGSIFKPRREVT
DQQQRAIRHDQILIS---------------------------------------------
-----------------------------------------PQQRSLVQIARNADSEVLN
VPSNRTVDSTLIFGITGLTGGLIAANLAQPWVYL-NATNDLQRKISSLFPFS-DQLEKHH
HFMRRTRSPLCNLLTKEKSVEVTKNLFCFTRRSVTLEQICL---DGLDASWEH---SIDY
KGSKMVC---------------------------------------------SKEN----
-----------LSCEEPFVKRGTTTFFQDASDAPAV----TLTIQLQKFTYHLNYD--NS
RDVHGETCR---HTLMIQLRVNIILIVEEDSQKWPMLLT-RIFGKHASKRP-----LIVK
DT--EEPILWTAPPLTQINTMVSSLGSKSFEKKKPKISRHFADYELNMLLAHAFCKDKT-
RGLEKKIVIITSFNNLFLSSTSDYFQSKLMLEQDLVTKV-QALDKLVLLRPGPLVGNHTH
QLQSPSIIDKPSFIPTAMFKVLKFKKNCIERKLQLLREISQVGIRTKLSELMARLAYQRS
CSPLLGHVVPAYKVAFVASIRAVF----SPD---SASF-VELI--KSDEIEKMA------
---
>CAGL0H07161g
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------MITTNLENTSGSL
SREKTFEKNILLFGSTGLTGSLVFEYLLDPCFYL-NSAVELRELLLEAIEE---------
---------------GLENVTIKTCLYCFNRKIGEPLDKYLKSPSANS---FG---PFCF
NGSQYHY---------------------------------------------NKGTCVPL
DIDQDIETSNDATFDGFLYYKDKGKNVTGKNPI-------SGEYYGKEYMYYLEYM--SA
EG----------NLLKLNFIFNHIQLIIKNSFSWPSVIP-IIFSDEVEAIS-----FR--
-E--KMPLKRYFPLLSDIKTMISTIGTTTNRNKISNTTYNDIDYQLNVDLVKAFSNTDD-
----KSVIIVTSFNNTIISTVSPYFKIKMKLESTLANAITPPLKTLTILRPGPLVG-RHS
DIYPTNDS--ILKNSSLFERALLHKKAFLQNMECFVDDIRTGGMSIKASEIVARTFYRIP
GSKLLGYCIPAQKVAYAISIAAVDKY--LHE----EPL-TRVV--TSEEMDNMK------
---
>Kpol_1051.4
------------------------------------------------------------
------------------------------------------------------------
---------------------------------------------------MITYKLPTS
CPEKNFSEKIPIVGSTGLEEKWPLVSLLDINFYL-LNSNEIKQKLNPRSDIEIPSNHQ--
---------------KMNTIKIVKNIFCINRR---SQTLDLFNKDALESVKVG---RIKF
KDLEYRL-----------------------------------------------------
-DKTPGETSYESSYLTNEIESGKINFDCEHPFS-------PLSFELQKKRAQLTYK--AK
EG----------NMLQIQFEISVYHIIIPTSNQWPTLLP-RIFNPATVIEK-----VE-D
KE--NSILPTGLPDLKNIPTMISSLGLNHRQQITREKSYRAIDFDLTLKLTQTFANNNN-
----KKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNELNPKLSQLVILRPGPIVGVPMT
DAINPEFNPILKKSDNLVEQSILLKKYLLDYKLATLKKYRSTGIAPRLTDILAKTMYRKP
GTSVLGYCIPATKVAKVAALKAIEPTIASTY---SKPD-VQII--TSRQIDELV------
---
>YDR317W
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------MS
YSVNTFTDYVLLFGSSSLVGKGILENLLDINLYI-KNVSDLQGKLDSLSE----------
---------------IKGNVVLNKHVFCVNRRCINEEKSFMKTIDYIN---MR---SVTW
QGGRYYL---------------------------------------------RSRK----
EKDTEKVPSSPNTFCYDNFEEGFIKNTPEERGKDGY----SFVYNQKQFSYTLHYA--CG
KE----------KGIEIICNFTVTQLIIPRSETWPKLLP-RIFSGTQKLEK-----FDID
NK--NYVPGRSLPSLCDISTMVCSLGSTSARVRRTQVPSSFADYYLPFNLAQEFTNTTN-
----KRLVVTTAFNNDFLSKTFEYFRIKAKLENDLDEALPNKLKELVILRPGPMCG-QHG
NPINVELG---KENSTFLEKIFYYPHYLLVYKKKYISEARRIGLRTKLSEIIASSIYRMP
GSALLGYAVPVSKVSYVASLMAIERK--SKE---AGPK-LEVI--SSYQIDMIV------
---
>Smik_4.576
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------MN
YRINAFTDYILLFGSSGLAGKGTLENMLDINFYI-KNVSDLQDKLNSLTE----------
---------------IKGDVVLNKHVFCINRRSITEEKSFMKSIDYIN---MK---SITW
KRGRYYL---------------------------------------------RSRN----
ENETKKIPSNPDTFCYDAFEEGFIKKTTDENGKDNF----CIPYNQKRFSYALYYA--SG
KK----------EGFEIIYKFTVTQLIIPRSENWSRLLS-YIFSGTQKLEK-----FDAN
NK--TYVAGKSLPNLRDISTMVCTLGSTSARVRRTQVPNSFVDYSLPFSLAQEFTNTTD-
----KRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKELIILRPGPMCG-QHG
NSIKVELD--VQENLTFSDKILYYPRYLLMYKKQYISEVRKIGLRTKLSELIASSTYRMP
GSALLGYSVPVSKVSYVASLMAIERK--SKE---AGPK-MEVI--NSYQIDMIA------
---
>Suva_2.486
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------MT
NINNAFTDSILLFGSSGLAGKGTLENLLDINFYI-KNVSDLQDKLDSLTE----------
---------------INENVVLNKHIFCINRKSVTEQKSFIKTIDYVN---MK---SIIW
KGGRYYL---------------------------------------------RSRG----
ENETKRETCNSNTFCYDDFEEGIIRNSMDKDKKGTF----SFAYNRKQFSYALHYA--CG
KD----------ESFGIKYNFIVTQLVIPQSTSWPKLLP-EVFSGTQKLER-----FDVD
SR--DYVSDKSLPALNSIGTMVCALGSSAARVRKSQVPNSFVDYHLSFNLAQEFTNTTD-
----KKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKELIILRPGPMCG-QHG
NPVHVEMD--IQQNPTLSERFFYYPRYILKYKQQCISEVRKVGLRTRLSEVIASSIYRMP
GSALLGYSVPVSKVSYVASLMAIEKK--SKE---AGPK-VEVI--NSYQIDMIA------
---
>Skud_4.583
------------------------------------------------------------
------------------------------------------------------------
----------------------------------------------------------MS
DNISVFTDYILLFGSSGLAGRGTLENLLDINFYI-KNVSDLQDKLDSLKE----------
---------------IKEDVVLNKHVFCINRRNVTEQKSFLKTIDYVN---MK---SITW
KGGRYYL---------------------------------------------RSRT----
ANDNGRETSSTDTFFYDNFEEGFIRGAAYEGQKGNF----SFAYNQKQFSYSLHYA--CR
KE----------ESFGIKYNFTVTQLIIPPSESWPRLLS-RIFSKEQKLEK-----FDID
NK--TYVADKSLPSLRDIGTMVCTLGSTSARVRRTQVPNSFVDYHLVFSLAQEFANTTN-
----KRLVVVTSFNNDLLMRTFEYFRIKAKLENDLEEALPNKLKELVILRPGPMCG-QHG
DPVNVKLD--VQENPTFSERILYYPRYVLKYKKQYISEARKVGLRTKLSELIASSIYRMP
GSALLGYSVPVSKVSYVTSLKAIEKR--SKE---AGPK-VEMI--NSYQIDMIA------
---
>ZYRO0F00550g
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------MSTDHNL
TKHQSFQDHILLFGSTGLIGSLTLEELLKVELYL-DAGNDLQSKLELYENS---------
---------------DINHFTLNKFFYCVNRK-LNNEKRSPGNEYLMERCKAT---PLVF
RGQDYYL---------------------------------------------HNNT----
SATPPASQSSNPSLGNNVFEEDGTIQLTKTVDNRSV----TLRFRQTRKSYQLEYI--SK
DL----------KNLLITFHFTIVQLVFEDSTRWADLLP-SIFSGEVELVP---------
EE--SNHTSPRLPHLDQVKTMICTLGPNSSSTKHSHYDRYFVEYQLTFQIVQNFASCED-
----KRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAPALAQLVVLRPGPIVG-NHV
NLNDRDLR--LRYSPSLCEQLKHYKEWCWEYKKSFVKEIRKIGFKTKASELVAKAMYRKP
GSSVLGYCVPASKAAYATAYMATNPT--LGE--------LRIV--TSKEIDHLT------
---
>TDEL0E02790
------------------------------------------------------------
------------------------------------------------------------
-----------------------------------------------------------M
IVIQQYNDHFLFFGSSGLIGSLTLKELLKADLYL-GNPENIQKRLNTCEHL---------
---------------NLSNFRFNKLIYCINRK-IGYKNILLDNEQYLKADKLA---PISF
NKADYRF---------------------------------------------EKIT----
SICPSVKKHSNQSLVNNVSDESGTLYIHNNSAGN------VLKYHRSMQTYQVEYK--SE
NS----------KKLLITFNFVILQIACPDSSKWCELLP-DIFSGCVALRS--------E
AE--PDGTTNKLPPLDEIPTMICTLGAGS---RQSKAKRHYVDYELTFKLAQSFNNCEG-
----KRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGKLVVLRPGPLVG-EHG
RPLTKSLT--IGHSTNMLKQILYYKEYCFQCKLALFKEFRRIGFRTRASELIARTMYRKP
GSWMLGYCIPATKAAYVAASKATDEA--SDE---ASDP-VEII--TSEQMDHIALH----
---