MUSCLE (3.8) multiple sequence alignment

AGR406C           ------------------------------------------------------------
Skud_3.7          -------------------MRLLLCKN-----------WFTSPVIS-----PLL------
Suva_3.156        -------------------MRLLLCKN-----------WFASPVIT-----PLL------
Smik_3.18         -------------------MRLLLCKN-----------WFTSPIIS-----PLL------
YCL057W           -------------------MRLLLCKN-----------WFASPVIS-----PLL------
CAGL0B00418g      --------MFSRSLSIIGRRVGNTLFR----SKKTTFALIALPLFVSYRGIHLNNTYTSS
TPHA0E03970       ---------MIQFLSPIIKSGIGKSFK----NKSILLSLVAIPAVA-----IGIYHQNNQ
TBLA0A07560       -----------MWLANQTSVLFLRCYG----LFAREFNYSIVFKNQ-----FNLRSIQNL
Kpol_2002.12      MFKAITTGLRNSNKNSNSIISGKTLKN----RKTRIVSFFAVPAIA-----FTI------
KNAG0C00260       -------MVNSGSLCKVT-RFLVKVSR----SKLTLLPFVVLPTAL-----FATSHFYQS
KLLA0C00572g      -------------------MRNVLANL----RFKSATSLVVIPTLA-----FASFQ----
SAKL0C00550g      ------------------MLILKRANK----FCSTTTSLLAIPALA-----FGAYSLLHS
NDAI0A00180       -------MIWSTGLTK---SLFNQISS----RKKLIVSSIVVPVVS-----VSLINIIQS
KAFR0D00180       -------MLNR-------LSRLVIPSR------KSFLSLVCIPATS-----YLV------
ZYRO0F18392g      -------------------MLLRSCSRVAGFTRKSIFSVVAVPALA-----IGIYRVS--
NCAS0B09070       -------MLWRIGLSRYSSTRIANKKL--------LISAIVLPATA-----FILTR----
                                                                              

AGR406C           --------MKDLAS--------LVPPQ-AAPSWNFSAQDVISLSHQLINQTEAVYHNVLQ
Skud_3.7          ---Y----TRCLSAMTNAASF-PIAPQ-APPTWSFTPTDIGGKTTEIIDKSNKFYELMSQ
Suva_3.156        ---Y----TRFLSSMTTTASF-PTAPQ-TPPSWSFTPNDISGRTKEIIEKSNKFYDSMSQ
Smik_3.18         ---Y----TRSLYSMSNATSF-PIAPQ-APPNWTFTPNDINGKTKEIIDKSNNFYESMSN
YCL057W           ---Y----TRSLYSMANTTSF-PIAPQ-APPNWSFTPSDISGKTNEIINNSNNFYDSMSK
CAGL0B00418g      IRNYSQLANTRFTNMPS-----LTPPQ-YPPSWEFKPEDILSQTKEFIANTKLFYDDLVA
TPHA0E03970       GLRF---YTASQVKMNEAA---FIAPQ-LSPKWDFSPERILSDAKKIIDTSNDFYNAMVA
TBLA0A07560       PLNF----KSSYSSMSSSACVNLNAPQ-AAPTWNWTPSQLVKDAEDLIDQSNHFYDALTN
Kpol_2002.12      ---------LKYSTMTNSSL--LIAPQ-PAPTWNWTPEGIVKDAESLIKDSNRIFDNLAA
KNAG0C00260       SRSY----SSTSSGLSRMSPQ-LVPPAGALPRWEFPSAKIGEEATRIIESTNKFYDELVE
KLLA0C00572g      ---F----NAIRSIMTKTD---FVVPQ-AAPSWNYTTEELLKQTHEAIDSSNELLDSLES
SAKL0C00550g      TNRTLRIPKSNYSTMSATMSATLVPPQ-AAPSWKYSPEDILQLTNETIASTSALHDALAG
NDAI0A00180       KRTY-SPNNIIMTNNTVNNKHGFIAPANTVPDWTWTPKQILDETKSYIEKTNKYYNSISE
KAFR0D00180       ---Y----NRLYSNMTISA---FIAPQ-AAPSWNWNPSRLLFDAECVIDNSNRLYDELSS
ZYRO0F18392g      --------KFQYSTMSSPNL--FIAPQ-SAPSWAFTPQSLLDETHRLIESSKQFYDSLAQ
NCAS0B09070       --------KSFYMTLPTNNKL-LVAPTGTAPTWKWSPESILAKTKEVIDNATNLYDSLAA
                                           *    * * : .  :   :   *  :      :  

AGR406C           EKPPTIDNYIMPLIYHEEETDLLWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSK
Skud_3.7          VESPSVTNFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLR
Suva_3.156        VESPAVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLR
Smik_3.18         VETPTVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLR
YCL057W           VESPSVSNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLR
CAGL0B00418g      IDNPTIENLIVPYINHENENELLINQLTFLQHVSEDKTIRDASMEATMLLQDFEIESGSR
TPHA0E03970       IENPSIENFVIPSINFENENSLAINQLTFLQHVSKDKLIRDASLEATELITNFDIEISLR
TBLA0A07560       LKSPDFNNFLVPYMNYENKVGSLINQLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLR
Kpol_2002.12      ISSPTVENFIVPYMNHENKVSPLINQLTFLQHVSADKDIRDSSMKATELIQNFEIEASLR
KNAG0C00260       ISNPSIDNLVKPYMNHENSIGLMVNQLCFLQHVSSDKEIREASNKATELLQNFEIETSLR
KLLA0C00572g      ISNPSVENFVTPYLHHENTISPLFNQLTFLQHVSSDKELRDTSTKVTELIENFGIESSLR
SAKL0C00550g      VENPTVESLVKPFLEHENTTQPLINQLTFLQHVSADKEVRDASTKATELLQDFEIEASLR
NDAI0A00180       IESPSIENLIIPYMNYENKMGLLINQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLR
KAFR0D00180       LKKPTVENLVRPYMIHENKISPLINKLCFLQHVSEDPKIREASLKATELLQKFEIEASLR
ZYRO0F18392g      LSNPTVENLVKPYMHHENGVGLIESQLTFPQQVSADKEIRDASVQATEFLQNFGIEQSLR
NCAS0B09070       IEEPSVESLVKPYMHYENDEGLIVNQLTFLQHVSADKLIRDASVEATELLQDFSIEASMR
                   . * . . : * : .*:      ..* * .:** :  :*::* . :  : .  *    .

AGR406C           YDLYQHFDEVWAQYKDDEKFK------KENFELYRYMEKDADGYRRSGMKVPVENRKRLD
Skud_3.7          HDIFLQFARVWQDAQPKADSL--------KKETFKYIEKSYKDFIHSGLELDEANRLKIK
Suva_3.156        HDVFLQFARVWQDAQSQADSI--------ERETFRYIEKSYKDYIHSGLELDEPDRLKVK
Smik_3.18         HDIYLQFARVWQDAQSKSDSI--------ERETFKYIEKSYKDYIHSGLELDESNRLKIK
YCL057W           HDIFLQFARVWQDVQSKADSV--------ERETFKYVEKSYKDYIHSGLELDEGNRLKIK
CAGL0B00418g      VDLFKQFDLIWNQIKDKKDEF-------EDFEIWRFVEKCHKDYVRAGLNLPADKLEKVK
TPHA0E03970       YDMFKQFDKIFNDLKDNKKYNDLKTATPKDYEIFKYVEKCHKDYVRSGLNLSEEKRNEIK
TBLA0A07560       YGLFLQFDKIWNQIKDSKDKY---EKDPKDLENYEFVRKVHRDFVRAGLNLDESKREKIK
Kpol_2002.12      KDLFIQFDKIWTDVKDNSEFNE--KSDSKNYESYRFIEKCHKDFIRSGLNLSDEKREIVK
KNAG0C00260       HDLFLQFDKIWKELKPRKEEF---SHDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVK
KLLA0C00572g      FKLFRQFDIVWNQLKDDAQFK------KDHFEIYKFVEKCHKDFLRSGLNLPEEQRDKVK
SAKL0C00550g      HDLFVQFDKVWQACKDDAKFK------KEHFELYKFVEKCHKDYVRAGLNLPEEKRNEVK
NDAI0A00180       WEIWEQFEKVWETVQNDDDFL-----KNHQFETYKFIEKIHKDSLRNGLK--SERNYQLK
KAFR0D00180       HDLFLQFDKIWQEISEKKDDF----VKEYDFETWKFIEKVHKDYVRSGLNLPEDKREKIK
ZYRO0F18392g      HDLFLQFDKIWNELKDKSFEQ-----GSQEYEIYKYVEKIHRDYTRDGLQLPEDKRDKVK
NCAS0B09070       LDLFQQFDKIWNQVKDDDDLK------SKDFETYKFIEKVHKDYVRNGLNLPEEKRNQVK
                    :: :*  ::   .                * : :: *   .  . *::        :.

AGR406C           EVKSKIAAAELEFSSNLGEEVEYIAFTKEELEGVPDTVLNQFEKII--EGGVEK-FKVTF
Skud_3.7          EIKKKISMNSINFSKNLGEQKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKVTF
Suva_3.156        EIKKKISVNSINFSKNLGEQKEFITFTKEQLEGVPDSILAQFETIESGKDSNETLYKVTF
Smik_3.18         DIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKVTF
YCL057W           EIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKVTF
CAGL0B00418g      EIKKKIADNCLKFSKNLGEQKEYILFTAEELKGVPESVIEQFEKVND-EFGIQK-LKVTY
TPHA0E03970       EIKKRIALNSLQFSKNLGEQNEFVAFTKEELEGVSDDVMKQFETYTDEQTGEQK-FKVTF
TBLA0A07560       EIKKAIANNSLKFATNLGEQTEFVAFTKEELDGVSDSVMEQFEKFNDEKTGKEM-YKVTF
Kpol_2002.12      DIQKKIASNSLNFSKNLGEQKEFIAFTKEELDGVSDAVMEQFEKFKDEKTGEEK-FKVTF
KNAG0C00260       DIKIKIASNSLEFSKNLGEQKEFLLFSKEQLDGVSDTVMEQFEQVKDETTNETN-YKVTF
KLLA0C00572g      EIKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVMKQFETVD--EDGITK-YKVTF
SAKL0C00550g      ELQKKISNNSLQFSKNLGEQKEFVAFTTEELDGVSASVMDQFEKFTD-TDGVEK-HKVSF
NDAI0A00180       YIKGKISADALTFSSNLGEQNEYVSFTKEELDGVSETVMDQFEKFIDPKTNEKK-YKVTF
KAFR0D00180       EIKIKIGNNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQFEKFIDEETGEEK-FKVTF
ZYRO0F18392g      QLKIKIAANSLEFSKNLGEQKEFVAFTKEELDGVSESVMDQFEQFKD-ENGTTK-YKVTF
NCAS0B09070       DIKKKIASNSLNYSKNLGEQKEYVSFTKEQLKGVSESVMEQFEKFVDPKTNEEK-YKVTF
                   ::  *.   : ::.****: * : *: *:* **.  :: ***             **::

AGR406C           KYPDIGPVLRLASNPETRRRASMADENRVAANEPLLFETLELRRELADLLGFKNFAAYNL
Skud_3.7          KYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADYNL
Suva_3.156        KYPDIFPVMKLASSSQTRKQAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANYNL
Smik_3.18         KYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYANYNL
YCL057W           KYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANYNL
CAGL0B00418g      KYPDIFPVLKNAQNPETRMKAFMGDQNKVPENEHLFKDTLKLRNELALVLGYDTYANYNL
TPHA0E03970       KYPDIFPVLKTAKNPNTRKIAFNADQNKVPENEKLFIDTLKLRYQLGKILGYDTYANYNL
TBLA0A07560       KYPDIFPVLKTARNPETRKKAFAGDQNKVSENTVLFTNTLKLRNQLADILGYSTYANYNL
Kpol_2002.12      KYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDTLKLRNDLSTVLDYSNYANYNL
KNAG0C00260       KYPDIFPVLKMAKNAETRKTAFCGDQNKVPQNEELFVATLKLRDELATLLGYDTYANYNL
KLLA0C00572g      KYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLRNDLAELLNYDSYADYNL
SAKL0C00550g      KYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEVLFLETLRLRDELAGLLGYSTYANYNL
NDAI0A00180       KYPDIFPVLKTAKNPKTRKIAFLGDQNKVPENEKLLCNVLKLRKELANTLGYSTYANYNL
KAFR0D00180       KYPDIFPVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRNELATTLNYSTYANYNL
ZYRO0F18392g      KYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQLRNELADILGYSTYANYNL
NCAS0B09070       KYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVETLKLRNQLAQLLGYSTYANYNL
                  ***** **:. *  .:**  *   *::.*. *  ::  .* ** .:.  *.:..:* ***

AGR406C           DDKMAKNEETVLKFLNDLVEKLLPVGKNDLEILKKKKAEDYK-SKNLTFDGEFYSWDTGY
Skud_3.7          YDKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVE-RSKKDEDPNYYIWDHRY
Suva_3.156        YDKMAKDSTTVMDFLNDLKKKLIPLGEKELQILQDMKAKDVK-KRNQDEDPNYYIWDHRY
Smik_3.18         YDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQEMKSKDVK-KLNQDEDPNYYIWDHRY
YCL057W           YDKMAEDSTTVMNFLNDLKDKLIPLGRKELQVLQDMKAEDVK-KLNQGADPNYYIWDHRY
CAGL0B00418g      DIKMAKNADTVLSFVNDLIVKLQDPAKKELDILKNLKKQEFENEFNMVYDGDYYIWDHRY
TPHA0E03970       DIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTEAQ-ELNMAYDDHYYIWDHRY
TBLA0A07560       ELKMAKAQDSVFKFLEDLIDRLKPLGSKEIEILKSIKEKEFK-ELNLPFDNHYYVWDHRY
Kpol_2002.12      EMKMAKNEETVFNFLDDLKTKLRPLGLKEIEILKQLKEKDMK-ELNLPYDNHYYIWDHRY
KNAG0C00260       EIKMAKKQSTVFKFLNDLKDKLKPLGEKEIGILKSIKEAECK-ELGVPFDGRYYIWDHRY
KLLA0C00572g      DIKMAKKEEAVLTFLNDLKNKLKPLGEKELTKLKNLKEEECK-ELNTPYDRRYYIWDNRY
SAKL0C00550g      DIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSLKEKDCK-ELAIPFDNHYYIWDNRY
NDAI0A00180       DIKMAKNQETVLKFLNDLKEKLKPLAEKEIKILKDLKKKECE-ELGIPYDGHYYIWDHRY
KAFR0D00180       EEKMAKRQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECK-ELNREYDSHYYIYDHRY
ZYRO0F18392g      ELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQKECE-SLGLPYDGHYYVWDHRY
NCAS0B09070       DIKMAKNQETVFDFVNNLKDKLKPLGQKEIETLKTLKKKDCE-ELGLAYDDHYYIWDHRY
                    ***:    *  *: :*  .*   . ::   *:  *  : :       *  :* :*  *

AGR406C           YTNKILRERYNVNPDDLAQYFPVESAIEGMLNIYTTLFRLKFVEIT-DECEKSVWH-EDV
Skud_3.7          YDNKHLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIETK-EPQNKSVWH-EDV
Suva_3.156        YDNKYLLENFNVDLEKISEFFPLETTITGMLQIYETLFNLKFIETK-NPQEKSVWH-EDV
Smik_3.18         YDNKYLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIEIK-DGQSKSVWH-DDV
YCL057W           YDNKYLLENFNVDLEKISEYFPLEATITGMLEIYETLFNLKFIETK-DSQNKSVWH-DDV
CAGL0B00418g      YDNKYLKENFNVDEEKIAEYYPLESTIDGMLKIYETLLKLKFVEVK---ENKKTWH-DDV
TPHA0E03970       YDNKYLKDKFNVDLEKISEYYPVESTIQGMLKIYETVMNLKFIEET-DKDLKSTWAGDDV
TBLA0A07560       YDNKYLKDNYNVDLEKISEYYPLDSTIEGMLNIYETLLNLKFIEEKDDSKNKNVWH-KEV
Kpol_2002.12      YDNKYLKDNFNVDLEKISEYYPIESSIDGMLKIYETVMKLKFVEET-DPAKRNVWH-EDV
KNAG0C00260       YDTKYLKDNFNVDHEAIAEYYPIDSTIEGMLKIYETVFKLKFVEEK-DTAKKNVWN-EDV
KLLA0C00572g      YDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKFIEED----NGDTWH-PDV
SAKL0C00550g      YDNKYLKENYNVDEEKISEYFPLEPTIGGMLKIYETVLKLKFVEET-DAEKKQVWH-EDV
NDAI0A00180       YDNKYLKDNFNVDIEKISEYYPLESTIDGMLKIYETVLNLKFIEET-DPLAKNVWH-PDV
KAFR0D00180       YDNKYLKDNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNEET---KNKSVWH-EDV
ZYRO0F18392g      YDNKYLKDNYNVDLEKISEYYPIESTISGMLSIYETLLKLKFVEET-DPEKRSVWH-EDV
NCAS0B09070       YDNKFLKDNYNVDLEQISEYYPLESTIKGMLGIYETLLKLKFVDET-NPKIKDVWH-EDV
                  * .: * ..:::: : :::::*:: :* *** **  ::.*** :        ..*   :*

AGR406C           KQFAVWNIDDEDNPKFQGWLYFDLHPRDGKYGHAANFGMVSAYRK-RDGSKSYPVTILVT
Skud_3.7          KQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMI-NDSKRSYPVTALVC
Suva_3.156        KQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMV-NDTTRSYPVTALVC
Smik_3.18         KQLAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHAANFGLSSSFMT-NDSVRSYPVTALVC
YCL057W           KQIAVWNMDDPKSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMI-DDTTRSYPVTALVC
CAGL0B00418g      KQLAVWKLDTPENPEFVGWIFFDLHPRDGKYGHAANFGLSSSYIS-ANGTRSYPITALVC
TPHA0E03970       KQLAVWKMDDPSKPEFVGWIYFDLHPREGKYGHAANFGMAPSYID-KDSKRIYPVTALVC
TBLA0A07560       KQLAVWKMDNPENPEFVGWIYFDLHPRDGKYGHAANFGISSSYIK-PNNERSYPVTALVC
Kpol_2002.12      KQLSVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAANFGISSSYVD-ENDKRSYPVTALVC
KNAG0C00260       KQIAVWKMDNVKTPVFVGWIYFDLHPRDGKYGHAANFGIASSYIR-EDGSRSYPVTALVC
KLLA0C00572g      KKLSVWKMDDNF-PSFVGWIYFDLHPREGKYGHAANFGISSSFLK-SDGSRSYPVTALVC
SAKL0C00550g      KQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHAANFGIASSYVR--DGARSHPVTALVC
NDAI0A00180       KQLSVWNMDDRANPAFVGWIYFDLYPRDGKYGHAANFGIASSYIT-EENKRSYPVTALVC
KAFR0D00180       KQLAVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDIETGKRSYPVTALVC
ZYRO0F18392g      KQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYGHAANFGISASYVK-EDGTRSYPVTALVC
NCAS0B09070       KQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYSHAANFGISSSYIT-QDGDRSFPVTALVC
                  *:::**::*    * * **::***:**:***.******: .::       . .*:* ** 

AGR406C           NFSKPTPTRPALLKLGELTTFFHELGHGIHDLVGSNDLESLNGPGSVPWDFVEAPSQMLE
Skud_3.7          NFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLE
Suva_3.156        NFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLE
Smik_3.18         NFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLE
YCL057W           NFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLE
CAGL0B00418g      NFSKSTKDKPSLLKHSEITTFFHELGHGIHDLVGNNRIGRFNGPGAVPWDFVEAPSQMLE
TPHA0E03970       NFSAATADKPALLKHNEITTFFHELGHGIHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLE
TBLA0A07560       NFSKVTADKPALLKHNEITTFFHELGHGIHDLVGKNNNSRFNGPGAVPWDFVEAPSQMLE
Kpol_2002.12      NFSKPTSDKPSLLKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLE
KNAG0C00260       NFSKSSATKPSLLKHNEITTFFHELGHGIHDLVGKNRAARFNGPGATPWDFVEAPSQMLE
KLLA0C00572g      NFSKPTKDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLE
SAKL0C00550g      NFSKPSAKKPALLKHSEITTFFHELGHGIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLE
NDAI0A00180       NFSKPTKNKPALLKHSEITTFFHELGHGIHDLVGQNKAARFNGPGSVPWDFVEAPSQMLE
KAFR0D00180       NFSKSTATRPSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFVEAPSQMLE
ZYRO0F18392g      NFSKPSAKKPSLLKHNEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLE
NCAS0B09070       NFSKSTDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQMLE
                  ***  :  .*:*** .*: *************** *    :***.:.*************

AGR406C           YWTARRDVLTMLSKHYETGEKIPKSLLDAWFSVGGLNSGLANLGQLKLGLFDMYVH---T
Skud_3.7          FWTWNKNELVSLSSHYKTGERIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVH--TC
Suva_3.156        FWTWNKNELMHLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVH--SC
Smik_3.18         FWTWNKNELIDLSSHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVH--TC
YCL057W           FWTWNKNELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVH--TC
CAGL0B00418g      FWTWNTKELLSLSQNYKDNAKIDTKLLESLIKTKHVNGALFALRQLHFGLFDMKVHMMSA
TPHA0E03970       FWTWNKNELLSLSKHYKTGEKIPESLLESLIATKHVNGALFALRQLHFGLFDMKVH--TT
TBLA0A07560       FWTWNKNELLSLSKHYKTGEKIPTELLNSLVATKHVNGALFALRQLHFGLFDMKVH--TS
Kpol_2002.12      FWTWNKNELISLSKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVH--TA
KNAG0C00260       FYTWDKNALQSLSKHYKTGEQIPEKLLDSLIATKHVNGALFALRQLHFGLFDMTVH--TS
KLLA0C00572g      FWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVH--TT
SAKL0C00550g      FWTWNKNELSTLSQHYETGEKIPEQLLDSLIATKHVNGALFALRQLTFGLFDMTVH--TC
NDAI0A00180       FWTWNKNELLSLSKHYKTGEKIPEDLLDSLISTKHVNGALFALRQLHFGLFDMTVH--TT
KAFR0D00180       FWTWNANELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFGLFDMTVH--TT
ZYRO0F18392g      FWTWNERELHELSSHYESGEKIPKDLLQSLISTKHVDGALFALRQLHFGLFDMYVH--TS
NCAS0B09070       FWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVH--TT
                  ::*     *  ** :*:   .*   *: : . .  ::..*  * ** :. *** **    

AGR406C           RD---YKGAEVRKLWNDLTREIGLMNLKNYTSTGYDSFGHIMAG-YAAGYYGYLWSQVFA
Skud_3.7          KD---LENLSICHTWNQLRQEISLMPNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFA
Suva_3.156        KD---LQNLSICDTWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFA
Smik_3.18         KD---LQNLSICETWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFA
YCL057W           KD---LQNLSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFA
CAGL0B00418g      EE---LDKLDIKKLWNDLREKICLISNGDQPTTGYNSFGHIMSGSYSAGYYGYMWAEVFA
TPHA0E03970       TDDNQIDNMDLVQLWNGLREEISLVENGDEMNKGYDSFGHIMSDSYSAGYYGYMWAEVFA
TBLA0A07560       KD---LENLDFLKLWNELREEVSLVENGDLFTKGYDSFGHIMSDSYSAGYYGYMWAEVFA
Kpol_2002.12      ED---VSKLNLLELWNGLREQICLVENGDEMSKGYDSFGHIMSGAYSAGYYGYMWAEVFA
KNAG0C00260       KD---VASLDLLKLWGDLRQEISLVENGGQYTKGYDSFGHIMSDSYSAGYYGYMWAEVFA
KLLA0C00572g      KD---ISKLNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFA
SAKL0C00550g      KD---LESLDVTSLWNDLRQEVSLVENGDQVTKGFNSFGHIMSGAYSAGYYGYMWAEVFA
NDAI0A00180       KD---IENLDLLKLWNESREEICLVENGENFTKGYNSFGHIISDSYSAGYYGYMWAEVFA
KAFR0D00180       NN---VESLNLLKLWNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWAEVFA
ZYRO0F18392g      KN---VAKLDLLKLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFA
NCAS0B09070       KN---VEDLNLLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFA
                   :       ..   *.    .: *:      ..*: *****::. *:******:*::***

AGR406C           ADMYDTKFKPNPFNATVGVEYRDTILATGGLYDMTDNLRKFLGRDPNNKAFLRGLGLKAR
Skud_3.7          TDMYHTKFAKDPLNTKNGVQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQS-
Suva_3.156        TDMYHTKFAKDPLNTKNGIQYRDIVLARGGLRDINDSLKEFLGREPSKDAFLKELGLQN-
Smik_3.18         TDMYHTKFAKDPLNTKNGIQYRDIVLARGGLNDIGDDLKKFLGREPSKDAFLKELGLQN-
YCL057W           TDMYHTKFAKDPLNAKNGIQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQN-
CAGL0B00418g      TDMYYTKFKADPLNPEVGVKYRDIVLARGGLYEIDDNLEEFLGRKPAKDAFLEELGLH--
TPHA0E03970       TDMYYSKFAKDPLNTKSGIEYRDIILARGGIRETNDNLKEFLGREPSKEAFLKELGLQ--
TBLA0A07560       TDMYYTKFAANPLETKVGVEYRDWVLARGGLYEIEDNLIQFLGRKPSNEAFLKELGLN--
Kpol_2002.12      TDMYYTKFAADPLNSKSGVEYRDIILSRGGIYEVNDNLEEFLGREPNNSAFLKEMGLN--
KNAG0C00260       TDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEIDDNLKEFLGREPSKDAFLKELGLQA-
KLLA0C00572g      SDMYYTKFLEDPLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKAFLKELGL---
SAKL0C00550g      ADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEIDDNLREFLGREPNNEAFLKELGLS--
NDAI0A00180       ADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEINDNLLEFLGREPSNKPFLKELGL---
KAFR0D00180       ADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEIADNLRDFLGREPSKNAFLKELGLDAA
ZYRO0F18392g      ADMYHTRFAADPLDSKAGVQYRDIVLGRGGLYETNDNLREFLGREPSEEAFLKELGLN--
NCAS0B09070       ADMYYTKFASDPLNSQAGVQYRDIVLANGGLYEIADKLKEFLGREPTNDAFLKELGLHN-
                  :*** :.*  :*::   *: *** :*. **: :  *.* .****.* :..**  :**   

FASTA FORMAT for MUSCLE Version 3.6

>AGR406C
------------------------------------------------------------
--------MKDLAS--------LVPPQ-AAPSWNFSAQDVISLSHQLINQTEAVYHNVLQ
EKPPTIDNYIMPLIYHEEETDLLWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSK
YDLYQHFDEVWAQYKDDEKFK------KENFELYRYMEKDADGYRRSGMKVPVENRKRLD
EVKSKIAAAELEFSSNLGEEVEYIAFTKEELEGVPDTVLNQFEKII--EGGVEK-FKVTF
KYPDIGPVLRLASNPETRRRASMADENRVAANEPLLFETLELRRELADLLGFKNFAAYNL
DDKMAKNEETVLKFLNDLVEKLLPVGKNDLEILKKKKAEDYK-SKNLTFDGEFYSWDTGY
YTNKILRERYNVNPDDLAQYFPVESAIEGMLNIYTTLFRLKFVEIT-DECEKSVWH-EDV
KQFAVWNIDDEDNPKFQGWLYFDLHPRDGKYGHAANFGMVSAYRK-RDGSKSYPVTILVT
NFSKPTPTRPALLKLGELTTFFHELGHGIHDLVGSNDLESLNGPGSVPWDFVEAPSQMLE
YWTARRDVLTMLSKHYETGEKIPKSLLDAWFSVGGLNSGLANLGQLKLGLFDMYVH---T
RD---YKGAEVRKLWNDLTREIGLMNLKNYTSTGYDSFGHIMAG-YAAGYYGYLWSQVFA
ADMYDTKFKPNPFNATVGVEYRDTILATGGLYDMTDNLRKFLGRDPNNKAFLRGLGLKAR
>Skud_3.7
-------------------MRLLLCKN-----------WFTSPVIS-----PLL------
---Y----TRCLSAMTNAASF-PIAPQ-APPTWSFTPTDIGGKTTEIIDKSNKFYELMSQ
VESPSVTNFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLR
HDIFLQFARVWQDAQPKADSL--------KKETFKYIEKSYKDFIHSGLELDEANRLKIK
EIKKKISMNSINFSKNLGEQKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKVTF
KYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADYNL
YDKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVE-RSKKDEDPNYYIWDHRY
YDNKHLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIETK-EPQNKSVWH-EDV
KQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMI-NDSKRSYPVTALVC
NFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLE
FWTWNKNELVSLSSHYKTGERIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVH--TC
KD---LENLSICHTWNQLRQEISLMPNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFA
TDMYHTKFAKDPLNTKNGVQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQS-
>Suva_3.156
-------------------MRLLLCKN-----------WFASPVIT-----PLL------
---Y----TRFLSSMTTTASF-PTAPQ-TPPSWSFTPNDISGRTKEIIEKSNKFYDSMSQ
VESPAVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKLDELNIDLSLR
HDVFLQFARVWQDAQSQADSI--------ERETFRYIEKSYKDYIHSGLELDEPDRLKVK
EIKKKISVNSINFSKNLGEQKEFITFTKEQLEGVPDSILAQFETIESGKDSNETLYKVTF
KYPDIFPVMKLASSSQTRKQAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANYNL
YDKMAKDSTTVMDFLNDLKKKLIPLGEKELQILQDMKAKDVK-KRNQDEDPNYYIWDHRY
YDNKYLLENFNVDLEKISEFFPLETTITGMLQIYETLFNLKFIETK-NPQEKSVWH-EDV
KQLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMV-NDTTRSYPVTALVC
NFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLE
FWTWNKNELMHLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVH--SC
KD---LQNLSICDTWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFA
TDMYHTKFAKDPLNTKNGIQYRDIVLARGGLRDINDSLKEFLGREPSKDAFLKELGLQN-
>Smik_3.18
-------------------MRLLLCKN-----------WFTSPIIS-----PLL------
---Y----TRSLYSMSNATSF-PIAPQ-APPNWTFTPNDINGKTKEIIDKSNNFYESMSN
VETPTVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLR
HDIYLQFARVWQDAQSKSDSI--------ERETFKYIEKSYKDYIHSGLELDESNRLKIK
DIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKVTF
KYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYANYNL
YDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQEMKSKDVK-KLNQDEDPNYYIWDHRY
YDNKYLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIEIK-DGQSKSVWH-DDV
KQLAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHAANFGLSSSFMT-NDSVRSYPVTALVC
NFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLE
FWTWNKNELIDLSSHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVH--TC
KD---LQNLSICETWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFA
TDMYHTKFAKDPLNTKNGIQYRDIVLARGGLNDIGDDLKKFLGREPSKDAFLKELGLQN-
>YCL057W
-------------------MRLLLCKN-----------WFASPVIS-----PLL------
---Y----TRSLYSMANTTSF-PIAPQ-APPNWSFTPSDISGKTNEIINNSNNFYDSMSK
VESPSVSNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLR
HDIFLQFARVWQDVQSKADSV--------ERETFKYVEKSYKDYIHSGLELDEGNRLKIK
EIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKVTF
KYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANYNL
YDKMAEDSTTVMNFLNDLKDKLIPLGRKELQVLQDMKAEDVK-KLNQGADPNYYIWDHRY
YDNKYLLENFNVDLEKISEYFPLEATITGMLEIYETLFNLKFIETK-DSQNKSVWH-DDV
KQIAVWNMDDPKSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMI-DDTTRSYPVTALVC
NFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLE
FWTWNKNELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVH--TC
KD---LQNLSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFA
TDMYHTKFAKDPLNAKNGIQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQN-
>CAGL0B00418g
--------MFSRSLSIIGRRVGNTLFR----SKKTTFALIALPLFVSYRGIHLNNTYTSS
IRNYSQLANTRFTNMPS-----LTPPQ-YPPSWEFKPEDILSQTKEFIANTKLFYDDLVA
IDNPTIENLIVPYINHENENELLINQLTFLQHVSEDKTIRDASMEATMLLQDFEIESGSR
VDLFKQFDLIWNQIKDKKDEF-------EDFEIWRFVEKCHKDYVRAGLNLPADKLEKVK
EIKKKIADNCLKFSKNLGEQKEYILFTAEELKGVPESVIEQFEKVND-EFGIQK-LKVTY
KYPDIFPVLKNAQNPETRMKAFMGDQNKVPENEHLFKDTLKLRNELALVLGYDTYANYNL
DIKMAKNADTVLSFVNDLIVKLQDPAKKELDILKNLKKQEFENEFNMVYDGDYYIWDHRY
YDNKYLKENFNVDEEKIAEYYPLESTIDGMLKIYETLLKLKFVEVK---ENKKTWH-DDV
KQLAVWKLDTPENPEFVGWIFFDLHPRDGKYGHAANFGLSSSYIS-ANGTRSYPITALVC
NFSKSTKDKPSLLKHSEITTFFHELGHGIHDLVGNNRIGRFNGPGAVPWDFVEAPSQMLE
FWTWNTKELLSLSQNYKDNAKIDTKLLESLIKTKHVNGALFALRQLHFGLFDMKVHMMSA
EE---LDKLDIKKLWNDLREKICLISNGDQPTTGYNSFGHIMSGSYSAGYYGYMWAEVFA
TDMYYTKFKADPLNPEVGVKYRDIVLARGGLYEIDDNLEEFLGRKPAKDAFLEELGLH--
>TPHA0E03970
---------MIQFLSPIIKSGIGKSFK----NKSILLSLVAIPAVA-----IGIYHQNNQ
GLRF---YTASQVKMNEAA---FIAPQ-LSPKWDFSPERILSDAKKIIDTSNDFYNAMVA
IENPSIENFVIPSINFENENSLAINQLTFLQHVSKDKLIRDASLEATELITNFDIEISLR
YDMFKQFDKIFNDLKDNKKYNDLKTATPKDYEIFKYVEKCHKDYVRSGLNLSEEKRNEIK
EIKKRIALNSLQFSKNLGEQNEFVAFTKEELEGVSDDVMKQFETYTDEQTGEQK-FKVTF
KYPDIFPVLKTAKNPNTRKIAFNADQNKVPENEKLFIDTLKLRYQLGKILGYDTYANYNL
DIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTEAQ-ELNMAYDDHYYIWDHRY
YDNKYLKDKFNVDLEKISEYYPVESTIQGMLKIYETVMNLKFIEET-DKDLKSTWAGDDV
KQLAVWKMDDPSKPEFVGWIYFDLHPREGKYGHAANFGMAPSYID-KDSKRIYPVTALVC
NFSAATADKPALLKHNEITTFFHELGHGIHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLE
FWTWNKNELLSLSKHYKTGEKIPESLLESLIATKHVNGALFALRQLHFGLFDMKVH--TT
TDDNQIDNMDLVQLWNGLREEISLVENGDEMNKGYDSFGHIMSDSYSAGYYGYMWAEVFA
TDMYYSKFAKDPLNTKSGIEYRDIILARGGIRETNDNLKEFLGREPSKEAFLKELGLQ--
>TBLA0A07560
-----------MWLANQTSVLFLRCYG----LFAREFNYSIVFKNQ-----FNLRSIQNL
PLNF----KSSYSSMSSSACVNLNAPQ-AAPTWNWTPSQLVKDAEDLIDQSNHFYDALTN
LKSPDFNNFLVPYMNYENKVGSLINQLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLR
YGLFLQFDKIWNQIKDSKDKY---EKDPKDLENYEFVRKVHRDFVRAGLNLDESKREKIK
EIKKAIANNSLKFATNLGEQTEFVAFTKEELDGVSDSVMEQFEKFNDEKTGKEM-YKVTF
KYPDIFPVLKTARNPETRKKAFAGDQNKVSENTVLFTNTLKLRNQLADILGYSTYANYNL
ELKMAKAQDSVFKFLEDLIDRLKPLGSKEIEILKSIKEKEFK-ELNLPFDNHYYVWDHRY
YDNKYLKDNYNVDLEKISEYYPLDSTIEGMLNIYETLLNLKFIEEKDDSKNKNVWH-KEV
KQLAVWKMDNPENPEFVGWIYFDLHPRDGKYGHAANFGISSSYIK-PNNERSYPVTALVC
NFSKVTADKPALLKHNEITTFFHELGHGIHDLVGKNNNSRFNGPGAVPWDFVEAPSQMLE
FWTWNKNELLSLSKHYKTGEKIPTELLNSLVATKHVNGALFALRQLHFGLFDMKVH--TS
KD---LENLDFLKLWNELREEVSLVENGDLFTKGYDSFGHIMSDSYSAGYYGYMWAEVFA
TDMYYTKFAANPLETKVGVEYRDWVLARGGLYEIEDNLIQFLGRKPSNEAFLKELGLN--
>Kpol_2002.12
MFKAITTGLRNSNKNSNSIISGKTLKN----RKTRIVSFFAVPAIA-----FTI------
---------LKYSTMTNSSL--LIAPQ-PAPTWNWTPEGIVKDAESLIKDSNRIFDNLAA
ISSPTVENFIVPYMNHENKVSPLINQLTFLQHVSADKDIRDSSMKATELIQNFEIEASLR
KDLFIQFDKIWTDVKDNSEFNE--KSDSKNYESYRFIEKCHKDFIRSGLNLSDEKREIVK
DIQKKIASNSLNFSKNLGEQKEFIAFTKEELDGVSDAVMEQFEKFKDEKTGEEK-FKVTF
KYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDTLKLRNDLSTVLDYSNYANYNL
EMKMAKNEETVFNFLDDLKTKLRPLGLKEIEILKQLKEKDMK-ELNLPYDNHYYIWDHRY
YDNKYLKDNFNVDLEKISEYYPIESSIDGMLKIYETVMKLKFVEET-DPAKRNVWH-EDV
KQLSVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAANFGISSSYVD-ENDKRSYPVTALVC
NFSKPTSDKPSLLKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLE
FWTWNKNELISLSKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVH--TA
ED---VSKLNLLELWNGLREQICLVENGDEMSKGYDSFGHIMSGAYSAGYYGYMWAEVFA
TDMYYTKFAADPLNSKSGVEYRDIILSRGGIYEVNDNLEEFLGREPNNSAFLKEMGLN--
>KNAG0C00260
-------MVNSGSLCKVT-RFLVKVSR----SKLTLLPFVVLPTAL-----FATSHFYQS
SRSY----SSTSSGLSRMSPQ-LVPPAGALPRWEFPSAKIGEEATRIIESTNKFYDELVE
ISNPSIDNLVKPYMNHENSIGLMVNQLCFLQHVSSDKEIREASNKATELLQNFEIETSLR
HDLFLQFDKIWKELKPRKEEF---SHDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVK
DIKIKIASNSLEFSKNLGEQKEFLLFSKEQLDGVSDTVMEQFEQVKDETTNETN-YKVTF
KYPDIFPVLKMAKNAETRKTAFCGDQNKVPQNEELFVATLKLRDELATLLGYDTYANYNL
EIKMAKKQSTVFKFLNDLKDKLKPLGEKEIGILKSIKEAECK-ELGVPFDGRYYIWDHRY
YDTKYLKDNFNVDHEAIAEYYPIDSTIEGMLKIYETVFKLKFVEEK-DTAKKNVWN-EDV
KQIAVWKMDNVKTPVFVGWIYFDLHPRDGKYGHAANFGIASSYIR-EDGSRSYPVTALVC
NFSKSSATKPSLLKHNEITTFFHELGHGIHDLVGKNRAARFNGPGATPWDFVEAPSQMLE
FYTWDKNALQSLSKHYKTGEQIPEKLLDSLIATKHVNGALFALRQLHFGLFDMTVH--TS
KD---VASLDLLKLWGDLRQEISLVENGGQYTKGYDSFGHIMSDSYSAGYYGYMWAEVFA
TDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEIDDNLKEFLGREPSKDAFLKELGLQA-
>KLLA0C00572g
-------------------MRNVLANL----RFKSATSLVVIPTLA-----FASFQ----
---F----NAIRSIMTKTD---FVVPQ-AAPSWNYTTEELLKQTHEAIDSSNELLDSLES
ISNPSVENFVTPYLHHENTISPLFNQLTFLQHVSSDKELRDTSTKVTELIENFGIESSLR
FKLFRQFDIVWNQLKDDAQFK------KDHFEIYKFVEKCHKDFLRSGLNLPEEQRDKVK
EIKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVMKQFETVD--EDGITK-YKVTF
KYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLRNDLAELLNYDSYADYNL
DIKMAKKEEAVLTFLNDLKNKLKPLGEKELTKLKNLKEEECK-ELNTPYDRRYYIWDNRY
YDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKFIEED----NGDTWH-PDV
KKLSVWKMDDNF-PSFVGWIYFDLHPREGKYGHAANFGISSSFLK-SDGSRSYPVTALVC
NFSKPTKDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLE
FWTWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVH--TT
KD---ISKLNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFA
SDMYYTKFLEDPLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKAFLKELGL---
>SAKL0C00550g
------------------MLILKRANK----FCSTTTSLLAIPALA-----FGAYSLLHS
TNRTLRIPKSNYSTMSATMSATLVPPQ-AAPSWKYSPEDILQLTNETIASTSALHDALAG
VENPTVESLVKPFLEHENTTQPLINQLTFLQHVSADKEVRDASTKATELLQDFEIEASLR
HDLFVQFDKVWQACKDDAKFK------KEHFELYKFVEKCHKDYVRAGLNLPEEKRNEVK
ELQKKISNNSLQFSKNLGEQKEFVAFTTEELDGVSASVMDQFEKFTD-TDGVEK-HKVSF
KYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEVLFLETLRLRDELAGLLGYSTYANYNL
DIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSLKEKDCK-ELAIPFDNHYYIWDNRY
YDNKYLKENYNVDEEKISEYFPLEPTIGGMLKIYETVLKLKFVEET-DAEKKQVWH-EDV
KQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHAANFGIASSYVR--DGARSHPVTALVC
NFSKPSAKKPALLKHSEITTFFHELGHGIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLE
FWTWNKNELSTLSQHYETGEKIPEQLLDSLIATKHVNGALFALRQLTFGLFDMTVH--TC
KD---LESLDVTSLWNDLRQEVSLVENGDQVTKGFNSFGHIMSGAYSAGYYGYMWAEVFA
ADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEIDDNLREFLGREPNNEAFLKELGLS--
>NDAI0A00180
-------MIWSTGLTK---SLFNQISS----RKKLIVSSIVVPVVS-----VSLINIIQS
KRTY-SPNNIIMTNNTVNNKHGFIAPANTVPDWTWTPKQILDETKSYIEKTNKYYNSISE
IESPSIENLIIPYMNYENKMGLLINQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLR
WEIWEQFEKVWETVQNDDDFL-----KNHQFETYKFIEKIHKDSLRNGLK--SERNYQLK
YIKGKISADALTFSSNLGEQNEYVSFTKEELDGVSETVMDQFEKFIDPKTNEKK-YKVTF
KYPDIFPVLKTAKNPKTRKIAFLGDQNKVPENEKLLCNVLKLRKELANTLGYSTYANYNL
DIKMAKNQETVLKFLNDLKEKLKPLAEKEIKILKDLKKKECE-ELGIPYDGHYYIWDHRY
YDNKYLKDNFNVDIEKISEYYPLESTIDGMLKIYETVLNLKFIEET-DPLAKNVWH-PDV
KQLSVWNMDDRANPAFVGWIYFDLYPRDGKYGHAANFGIASSYIT-EENKRSYPVTALVC
NFSKPTKNKPALLKHSEITTFFHELGHGIHDLVGQNKAARFNGPGSVPWDFVEAPSQMLE
FWTWNKNELLSLSKHYKTGEKIPEDLLDSLISTKHVNGALFALRQLHFGLFDMTVH--TT
KD---IENLDLLKLWNESREEICLVENGENFTKGYNSFGHIISDSYSAGYYGYMWAEVFA
ADMYHTKFAPNPLDVSVGIKYRDLILAKGGLYEINDNLLEFLGREPSNKPFLKELGL---
>KAFR0D00180
-------MLNR-------LSRLVIPSR------KSFLSLVCIPATS-----YLV------
---Y----NRLYSNMTISA---FIAPQ-AAPSWNWNPSRLLFDAECVIDNSNRLYDELSS
LKKPTVENLVRPYMIHENKISPLINKLCFLQHVSEDPKIREASLKATELLQKFEIEASLR
HDLFLQFDKIWQEISEKKDDF----VKEYDFETWKFIEKVHKDYVRSGLNLPEDKREKIK
EIKIKIGNNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQFEKFIDEETGEEK-FKVTF
KYPDIFPVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRNELATTLNYSTYANYNL
EEKMAKRQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECK-ELNREYDSHYYIYDHRY
YDNKYLKDNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNEET---KNKSVWH-EDV
KQLAVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDIETGKRSYPVTALVC
NFSKSTATRPSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFVEAPSQMLE
FWTWNANELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFGLFDMTVH--TT
NN---VESLNLLKLWNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWAEVFA
ADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEIADNLRDFLGREPSKNAFLKELGLDAA
>ZYRO0F18392g
-------------------MLLRSCSRVAGFTRKSIFSVVAVPALA-----IGIYRVS--
--------KFQYSTMSSPNL--FIAPQ-SAPSWAFTPQSLLDETHRLIESSKQFYDSLAQ
LSNPTVENLVKPYMHHENGVGLIESQLTFPQQVSADKEIRDASVQATEFLQNFGIEQSLR
HDLFLQFDKIWNELKDKSFEQ-----GSQEYEIYKYVEKIHRDYTRDGLQLPEDKRDKVK
QLKIKIAANSLEFSKNLGEQKEFVAFTKEELDGVSESVMDQFEQFKD-ENGTTK-YKVTF
KYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQLRNELADILGYSTYANYNL
ELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQKECE-SLGLPYDGHYYVWDHRY
YDNKYLKDNYNVDLEKISEYYPIESTISGMLSIYETLLKLKFVEET-DPEKRSVWH-EDV
KQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYGHAANFGISASYVK-EDGTRSYPVTALVC
NFSKPSAKKPSLLKHNEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLE
FWTWNERELHELSSHYESGEKIPKDLLQSLISTKHVDGALFALRQLHFGLFDMYVH--TS
KN---VAKLDLLKLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFA
ADMYHTRFAADPLDSKAGVQYRDIVLGRGGLYETNDNLREFLGREPSEEAFLKELGLN--
>NCAS0B09070
-------MLWRIGLSRYSSTRIANKKL--------LISAIVLPATA-----FILTR----
--------KSFYMTLPTNNKL-LVAPTGTAPTWKWSPESILAKTKEVIDNATNLYDSLAA
IEEPSVESLVKPYMHYENDEGLIVNQLTFLQHVSADKLIRDASVEATELLQDFSIEASMR
LDLFQQFDKIWNQVKDDDDLK------SKDFETYKFIEKVHKDYVRNGLNLPEEKRNQVK
DIKKKIASNSLNYSKNLGEQKEYVSFTKEQLKGVSESVMEQFEKFVDPKTNEEK-YKVTF
KYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVETLKLRNQLAQLLGYSTYANYNL
DIKMAKNQETVFDFVNNLKDKLKPLGQKEIETLKTLKKKDCE-ELGLAYDDHYYIWDHRY
YDNKFLKDNYNVDLEQISEYYPLESTIKGMLGIYETLLKLKFVDET-NPKIKDVWH-EDV
KQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYSHAANFGISSSYIT-QDGDRSFPVTALVC
NFSKSTDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQMLE
FWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVH--TT
KN---VEDLNLLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFA
ADMYYTKFASDPLNSQAGVQYRDIVLANGGLYEIADKLKEFLGREPTNDAFLKELGLHN-